KEGG   Pichia pastoris: PAS_FragB_0039Help
Entry
PAS_FragB_0039    CDS       T01092                                 

Definition
DNA-dependent ATPase
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ppa  Pichia pastoris
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2730924..2733446)
Genome map
AA seq 840 aa AA seqDB search
MYKKPMNRPFKPPRMQEATNKPVKPAQPAKIFKRKPEVLSPGTPEVAQTRTTNSVNVLWR
KKTLKKNKTWDGDGILVITGDQLIFKCDPLGGSNLREQGRRSKSSKSLEGVIAIGNYEIE
LDGEISDVKPASKKHRKIEHEVSSEKESITSADKKSSSLPFKSPMTNSVTRQPQKKSAPP
YKSDYEHSIVLSQESETSKMVVVDPLLSQHLRPHQREGVKFLYNCLDGSKELPHKGCILA
DEMGLGKTLTTITLIWTLLKQNQVDHKRPAVKKVLVVCPVTLIHNWKREFRKWLGMNRVS
ILEMSSASNVEEDKRSVINFGRTRVYQILILGYEKLQKLTNEISQINVDLLVCDEGHRLK
NSNNKVMKSLTSFQIPRKIILTGTPIQNDLNEFYNIINFVQPGIVGDFASFNRDYMRPIL
QAREINCLNRKIIKAGNEKSNSLVELTQKFILRRKAKDINTNFLPPKTELILMVPMTELQ
QELYKDIIETNQAKLGLINDRNFFLQKILILRKICNSPSLLKDEPDFARYNLGNRFNSGK
IKLTVLLLRKLFETTNEKCVIVSNFTKTLDVLQLIIEHNNWKYHRLDGSSKGRDKIVRDF
NESPQKDRFIMLLSSKAGGVGLNLIGASRLILFDNDWNPSVDIQAMARVHRDGQKRHTFI
YRLYTKGTIDEKILQRQLMKQNLSDKFLDDNDSSKDDVFNDYDLKDLFTVDLDTNCSTHD
LMECLCNGRLRDPTPVLEAEECKTKPLEAVDDTDDGWMSALDFKQLSQKEETGAVSTMRQ
CLLGYQHIDPKILEPTEPVGDDLVLANILAESSGLAKSALSSEKKPKKPVVNFIFVSGQD
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaagcccatgaatcggccgtttaaaccgccgaggatgcaagaggccactaat
aaaccagtaaaaccagcccagcctgcgaaaattttcaaaagaaaaccagaagttttgtct
cctgggacacctgaagttgcacaaacaaggactacgaactccgtcaatgttctatggaga
aaaaagaccctcaagaagaataagacttgggacggtgatgggatcttagtgattacggga
gaccagttgattttcaaatgtgacccgttgggaggttccaacttaagagaacagggtaga
agatccaaatcttcaaagagtcttgaaggtgttatagccataggcaattacgaaatagaa
cttgatggcgagatttctgacgtgaagcctgcttcgaagaaacatagaaaaatagaacat
gaggttagttcggaaaaagaatccataacttcagcagataagaaatcttcctcccttccc
ttcaagagccccatgacaaattcagtgactagacaaccacagaagaaaagcgctccacca
tataaatcagattatgagcattcgattgtactatctcaagaatcggagacttctaaaatg
gtagtagtggatccgttgctcagccaacatttgagacctcaccaaagggagggtgtgaaa
tttctttacaattgtctggatggctccaaagagttgccacataaaggatgtatattagca
gatgaaatgggacttggaaagacattgaccacaattaccctcatttggactttacttaaa
caaaaccaggttgatcacaaacgaccagcagtgaagaaggtactggttgtgtgtcctgtt
actctgatacacaattggaaaagagaatttcgaaagtggcttggaatgaatagggtcagt
attttggaaatgagcagtgcatcaaatgtagaagaagacaaacgaagtgtgatcaacttt
ggacgaaccagagtgtaccaaatattgatcttaggttatgaaaaactgcaaaagttgacg
aatgaaatttcccaaattaacgttgatttgttggtatgtgatgagggacaccggttgaag
aactcaaacaataaggtgatgaaaagtttgactagtttccagattcctcgtaaaataatt
ttgacaggaactccaatccaaaatgatttgaatgaattctataatatcatcaattttgtt
cagcctggaattgttggagattttgctagttttaacagggactacatgaggccgattctt
caagccagggaaattaattgcttgaaccggaaaatcattaaggcaggcaacgaaaaatcc
aactccttggttgaattgactcaaaagtttatcttacggagaaaagctaaagacatcaat
acgaatttccttccgccaaaaactgaactgatactgatggttccaatgactgaattacaa
caggagctatacaaggatataattgaaactaaccaagccaagcttggcttgatcaacgac
agaaacttttttcttcaaaaaattttgattcttcgtaaaatatgcaattcaccctccctg
ctgaaagacgaacctgattttgccagatacaatctcggcaatagattcaatagcggtaag
atcaagctaacagtactgcttttacgaaagctgtttgaaaccaccaatgagaagtgtgtg
attgtttcaaacttcactaaaactttggacgtacttcagctaatcatagagcacaacaat
tggaaataccaccgactagatggttcgagtaaaggacgggacaaaatcgtacgagatttt
aacgagtcgcctcaaaaagatcgattcatcatgttgctttcttccaaggcagggggagtg
gggctcaacttaattggagcctcacgcttaattctttttgataacgactggaatcccagt
gttgacattcaagcaatggctagagtgcatcgagacgggcagaaaaggcacacctttatc
tatcgtttgtatacgaaaggcacaattgacgaaaagatcctacaaaggcaattgatgaaa
caaaatctgagcgacaaattcctggatgataatgatagcagcaaggatgatgtgtttaac
gactacgatctcaaagatttgtttactgtagatcttgacacgaattgtagtacacacgat
ttgatggaatgtttatgtaatgggcggctgagagatccgactcccgtcttggaagcagaa
gaatgcaagacaaaaccgttggaggccgttgacgacacggatgatggttggatgtcagct
ctggatttcaaacagttatcacaaaaagaggagacaggtgctgtgtcaacaatgcgtcaa
tgtctgctcggatatcaacacattgatccaaagattttggaaccaacagaacctgtaggg
gacgatttggtattggcaaacatcctcgcggagtcctcaggcttggctaaatctgcattg
tcatctgaaaagaaacccaagaaaccagtggtgaactttatctttgtgtcaggccaagac
taa

DBGET integrated database retrieval system