KEGG   Pichia pastoris: PAS_chr1-1_0009Help
Entry
PAS_chr1-1_0009   CDS       T01092                                 

Definition
Serine esterase that deacylates exogenous lysophospholipids
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ppa  Pichia pastoris
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ppa00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:552345..556775
Genome map
AA seq 1476 aa AA seqDB search
MSNRLLIFLLIALIQGAWMLTDELPVLSVESSNPDLGLISVSPSPLSPDVGTFSKDQLAD
NGLPSPRDSTSSISFVTATIWFISWCFFKVIRSVLVVLPSFIVRILGFNYSVTLNFSSLL
MIVSSTVVIVYAFIRYRYLNLYSRLPQEPKRQDPPMDVFIESTDDNSEVRFPSYLDQFLS
AIKVFGYLEKTVFHELTKSMTTQKLELNESLVIDASKGFSIVVEGRMSVYARVGRKMVSD
DTLAAEYESANSDEKSFIFNGYKYQLLTDAKSGSPLSSLISILKLFTENEEKLLQDNRTS
SALNLNAVYEANSPFREEPTSSSPEEQADPDEFAPELIAKAQGHASISTIPPESFRRLVV
KYPQSASHIVQMVLTRLYRVTLQTAHSYLGLTHKIMKAELELNMLAQYDIPVYLHDGIID
RLDEQFKAAEEEDNIETISVSKSTSNFKKNNGLLQHHPERTSHDKRFFYYNPAGRISKSV
SSKPSKRPVLSKRNSSHHVVLDTRITNTNPGDLLSNVPLSRKNSSYNSLRNSDQSKDEQE
IRARTFSAEEETADTALRTALVESIFKLIGIDNSIVHNSANLFASYLSLNDPLNSPNFGL
QKSYPSSQNLKWFSLDVGDDDDSSCSSKSETPGAGSHKSSEPVLDLVSIRKSASEQIQFM
FIKAGHVIIEENQPTPGIYYLVSGLLESVFTAENGEEKMLNHIKPGGIAGYLGVVASFKS
FITVRAKSNCYVGFLPKKVIDSLCDKYSVIQLALAKTLIRVLDDNILLMDFAMDWVQTSA
GQRLYNQGDPANGIYIVLNGRFRSIVENPKGAVNDKQSSPVIHRKDAYSGENDSISVISE
HGRGESLGEIEVLTASKRPTTLVAVRDSETARIPRSLFEMLCLTNPSIMIKVSRLVAERS
QSTEANLVIGANSFKNPVIKPKNSSFCNYSYRTITILPITKGLPVEEFAQKLVSSFEQLD
RSVISLNQASILTHLGKHAFDKLAKMKQSGYFADLEEQYQNVIYVTDTPVNSTWTSTCIS
QGDIILLLADAQSSTDIGEYERLLVRKKTTARTELILLHPERYVEAGSTSKFLKNRIWVH
SHHHVQMNVNRGHFVAKATELSSIAQLVKESYSQLKNKAHLDKMRHRLETLLVSYDVFKK
VPNIGRTGYYQPTQEHKNDFMRLARILSGQAIGLVFGGGGARGCAHIGVLKALEEYGIPV
DLVGGTSIGAFVGGLYAKDYNLVSTYGRTKSFAGRMSSLWRIITDLTYPVTSYMTGHEFN
RGIWKAFGDYRIEDFWVKYYCNSTNITNSVQEIHSSGYAWRYIRASMTLAGLLPPITDNG
SMLLDGGYVDNLPVEEMKNQGASVIFAIDVGSVDDRSPMDYGDSLSGFWVVLNRWNPFSK
HPNVPSIAEIQLRLAYVASVNALEQAKSQDAVVYLRPPIEMYGTLDFGKFEEISNVGNAY
GSSQLKELEEDNELPEVLKSRKKQTHKINIDRRNSI
NT seq 4431 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacagacttttgatttttctgctcattgcgttgattcagggtgcttggatgctt
actgatgagttacccgtgctatctgtggaaagtagcaatcctgatttgggtctgatctcc
gtttccccttctcctttatctccagatgtgggcactttttcaaaggatcaactggcagat
aacggtctcccctcacctagagactccaccagctccatttcatttgtcacagcgactatc
tggttcatttcatggtgttttttcaaggtaatacggtctgttctggtggtattgccctcg
tttattgtccgcatccttgggtttaattacagtgtaactttgaatttttcgtctttattg
atgattgtttcatccaccgttgttatagtgtatgcattcatcaggtacagataccttaat
ttgtactcccgacttcctcaagaaccaaaacgtcaggaccctcctatggatgtatttatc
gaatctactgatgacaattctgaagtgagatttcccagctacttagatcagtttttgtcc
gctatcaaggtgtttggttatttagagaaaaccgtttttcatgaactgacaaagagtatg
acaacccaaaaattggagctcaatgagtcgttggtaattgatgcgtctaaagggttctct
attgttgtagagggcaggatgtcagtgtacgcaagggttggtaggaaaatggtgtccgat
gatacactggctgccgaatatgaatctgcaaattccgatgagaagtcgttcatcttcaat
ggctataagtatcaactgttgaccgatgctaaaagtggtagtccactttcatctttgatt
agtatactaaaacttttcacagagaacgaggagaaacttttacaggacaacagaacctct
tcggctttaaacttgaatgctgtttatgaagcgaactccccgttcagggaggagccaaca
tccagctcgccggaagagcaggcagaccccgacgagtttgcaccagaactaattgccaag
gcccaagggcatgcttctatttctactattccacctgaatcatttcgaagattggttgtg
aagtatcctcagtcggcatcgcatattgtccaaatggttcttacccgcttgtacagagta
acgcttcaaactgcacattcgtacctgggattgactcacaaaattatgaaagctgagcta
gaactgaacatgttagctcaatacgatatccccgtctatcttcacgatgggattattgac
agactagatgagcagtttaaggctgcggaagaagaagataatatcgaaaccattagtgtt
agcaagagcacctccaatttcaagaaaaacaacggtctactgcagcatcatcctgaacgg
acaagtcatgataaaagattcttctactataatcccgctggaagaatctccaaatccgtc
tcttcaaaaccatcaaagagacccgttttatctaagagaaacagctctcaccatgttgtt
ctcgatacccgaatcaccaatactaatcccggtgatttgctttcaaatgtgcctttatcc
agaaagaactcatcctacaattctcttcgaaatagtgaccaatccaaggacgaacaagag
atccgagcaagaactttttcggctgaagaagaaactgcagatacggcactaagaacagca
ttggttgaaagcatattcaagttgattggtattgacaactccatcgttcataatagcgcc
aatctgttcgcttcatatctttcacttaacgatccgctaaacagccctaattttgggctt
cagaaaagttacccatcgtcacagaatttgaaatggttcagcttggatgttggagatgat
gatgattctagctgcagtagtaaaagtgaaactcctggagcaggttcacacaagtcaagt
gaacctgtccttgatctggtttcgattcgaaaatcggccagcgaacaaattcagtttatg
ttcatcaaagctggccatgttataattgaagaaaatcagccaactcctggtatctactac
cttgttagtggactcttagagtcagttttcacggcagagaatggagaagaaaaaatgctt
aaccatataaaaccaggtggaattgctggttacctgggcgttgtagctagcttcaaatca
tttattacggtaagggctaaatcgaattgctatgttggatttcttccaaagaaagtgatt
gattccttatgtgataagtattctgtcattcaattggcgctagccaagaccttgatcaga
gttttggacgataatatccttttgatggattttgctatggactgggtacaaacatctgca
ggacagagactgtacaatcagggagaccctgcaaatggtatttatatcgttctgaatggt
agatttcggtccattgtcgagaatcccaaaggtgcggtcaatgacaaacaatcttcgcca
gtgattcaccggaaggatgcttatagtggtgaaaatgacagcatatctgttatatcagag
catggaagaggtgaatctttgggagaaatagaagtacttactgcttcaaagagacccaca
actttggtagctgtgcgagactctgagacagctagaattcctagaagtctgtttgagatg
ctatgtcttacaaatccatctatcatgattaaggtttctagattagttgcagaacgatct
caatcaacagaagcaaacttagtgataggtgccaacagcttcaaaaatccagtcattaag
ccaaaaaattccagtttctgtaactacagttaccggactattaccatcttgccaattacc
aagggtcttccggtggaagagtttgctcagaaattagtttcttcgtttgaacagctagat
agatctgttatttctttgaatcaggcaagcattttgactcacctaggaaaacatgctttt
gataaactagccaagatgaaacaatcgggctactttgccgatttggaggaacaataccag
aatgttatatatgtcacagacactccggtaaactcaacttggacaagtacttgcatttct
caaggtgacattattcttttgctagcagatgctcagtcttcgacggatattggagagtat
gagagacttctggtgagaaaaaagaccactgcgagaacagaacttattttgttgcaccca
gaacgatatgtcgaagctggatcaacaagcaaattcctgaagaatagaatttgggttcat
tcacatcaccatgtacaaatgaacgtgaatagaggccattttgttgccaaagcaaccgaa
ctatcatcgattgctcaactggtcaaagaaagttattcccagctgaaaaataaggcccac
ttagacaagatgagacaccgtttggagactttactggtcagctacgatgtcttcaagaag
gtacccaatatcggacgcactggatactatcaacctactcaagaacataaaaatgatttc
atgcgacttgcaagaattttgtcaggacaggccattggattagtttttggtggaggtgga
gctcgtggatgcgcccatattggtgttcttaaggcccttgaagagtatgggattcctgtt
gatctggtaggaggaacttcgatcggtgcttttgtcggaggactttatgcaaaggattat
aacttagtctcaacttatggtaggaccaaaagctttgctggacgaatgtccagtctttgg
agaattattaccgatttgacgtatcctgtaacgtcctatatgacaggacacgagttcaat
cgtggaatctggaaggcatttggagactatcgaatagaagacttttgggtcaagtactac
tgtaattctacgaacatcactaacagtgtgcaagagatccattcgtcaggttatgcttgg
aggtacatccgagcttccatgacccttgctggtctgctgcctcctatcaccgataatggc
tcaatgttgctagacggaggctatgttgataatttgccagtggaagaaatgaaaaaccaa
ggtgctagtgtgatatttgctattgacgttggttcggtggatgatcgaagtcccatggac
tacggagattctttatcgggattttgggttgtcctcaaccgttggaatccgttttcaaaa
catccgaacgttccaagtattgcagaaattcagctgagacttgcatatgtggcttctgtt
aatgctttagaacaggcaaagtctcaagatgcagttgtatacttacgaccaccaatcgaa
atgtatggaactttagattttggaaagtttgaagagatttctaatgttggtaatgcttat
ggttcttcccaactgaaagagttagaagaggataacgagctaccagaggttttgaagtca
agaaaaaaacaaacacataagatcaacattgatcgaagaaactcaatttag

DBGET integrated database retrieval system