KEGG   Pichia pastoris: PAS_chr1-1_0040Help
Entry
PAS_chr1-1_0040   CDS       T01092                                 

Definition
Ubiquitin carboxyl-terminal hydrolase
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:618896..621763
Genome map
AA seq 955 aa AA seqDB search
MLVETPMSTKMNGTKTPLHDTQSQLEIYYRQVALNELKNLEATIQRDRSTLSLATKASTK
INPRFSNSRYHKVIDLIDMSEHCYEKSYQSYKSHHNETGVAMYLKGYIILTIIIPGIGSD
CSMWKNDDVELFNTLKRLYEESLNTELMRKVVNDLKIQDGNMDGKVVAMNESFSADQQLD
RVPKPRSLSPIKRSTANVNLSEYSSQGESQNSTQAPTFKGDQAPPDYTYTVTEFQAPTDL
KSRERLDTKSISSAEADTGDVLDIYQYVDTNGGGVPNSPEVESTLQSPSKVTETNSSMDE
FVPHIDVATLNGILFSPSVQSKKILLLDLRSSVDFEKSRIRYQNIVNIEAHVLRSSTSDQ
QIEKLLQMTNPTFYQLFSTRDQFSTIIYFDKDSKVPSNDMTRLYNMLTSLNTSKMLSDLP
IFLQGGMDEWLKYYSTEPMKVFYADRKLKGPRKLPESAPPPIPNTDYLKPLTQTTSYLPR
AETQINSSPHRPRQNTPPKLFSHNDRTSTTPFNNGDQYNHTIPQYRAKQVLHPSHALSTI
PPPIDQAQVTQTRKPVYEELSICGLKNFGSTCYINSMVQCLFSFGEFKKIFLTDQFTRYL
TRSPTNTLALSVAGLFRSMTANGGMSISPTRFLSVCNYYRPDLRIPQEQQDTQEFLMFIL
DKIHEELNYPSIVKLDFPHSTAPQLDDKQYRKWFSELTEKEGVSPISTMFQGQLKSTLIC
NQCGNQSGSFTQFQILSLPIPPSHHNMVAVNDCINHFIQPEVLRGDNAWSCPECEKREKR
RKEEMSQMNNSVFNDEEKKRSRKLFKMLGSKEKHSPNSNHSKANLVKTSQKALSFISLPQ
YLVIHLSRFNGFSPQACKLDVTIAYPLILEIPIHKEDGSMNVARYKLCSLINHFGSLKSG
HYTAVVNKSGHLHNPYWCYFDDESVRPGISHGDLNLGINMLSSRDVYVLFYERIA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgttagtggagactccaatgtcgacaaaaatgaacggcacaaaaacaccgcttcatgac
actcaaagtcagttggagatatactacagacaagtagcgttgaatgaattgaaaaatctt
gaggctaccatccaaagagacaggtccactctctctttggcaaccaaagcatcaactaag
atcaatcctagattctctaattccaggtatcacaaggtcatagatttgattgacatgagc
gaacattgctatgaaaagagttatcaatcttataaatcccaccataatgagactggtgtg
gctatgtatttgaaaggatatatcatattgaccattattattccaggtattggctcggat
tgttcaatgtggaagaatgatgatgtggagttgtttaatactctcaaaagactgtatgag
gagtctttaaatacagagctaatgaggaaagtagtcaacgatctaaaaatccaggatggc
aacatggacggcaaagttgttgccatgaacgaaagcttttcagctgaccaacaactggat
agagtccctaagccaagatcattgtctcccatcaaaaggtctactgctaacgttaatttg
tcagaatacagctcacagggggaatcacagaattctactcaagcacctacgttcaaaggg
gatcaggcacctcctgattatacatacacagtgactgaattccaagccccaacagatcta
aaatccagggaacgtttggacacaaaaagcatttcttccgccgaagctgatacaggagac
gtactagacatttaccaatatgtggatacaaatggaggcggcgtgccaaattcacctgag
gttgaaagtactcttcaatcgccctcaaaggttaccgaaaccaattctagtatggatgaa
tttgtgcctcatattgatgtggctactttgaacggaattcttttttctccctcagttcaa
tcaaagaagattttgttgttggatttgagatctagcgtcgacttcgaaaaatcacgaata
agataccagaatattgtcaatatcgaagcacatgtccttagaagttcaaccagtgatcag
cagattgaaaagctactgcaaatgacaaatccaactttttatcagcttttcagtacaagg
gatcaattttcaaccataatatatttcgataaagactcgaaggtaccttcaaacgacatg
accaggttatacaatatgttaacaagcctgaatacttccaaaatgttgtctgatttaccg
atattcttgcaaggtggaatggatgaatggttaaagtactattctacggagcccatgaaa
gtcttctacgctgacagaaaactgaaagggcccagaaaattgccagaatctgctcctcct
ccaattcctaataccgactacttgaagccccttactcaaactacatcatacttgccgaga
gcagaaacacagataaattcatcgccccatagacccagacaaaatacgcctcctaaactg
ttttctcacaatgatcgaacttcaactactcccttcaataatggtgatcagtacaatcac
accatacctcagtatagggcaaagcaggtattacatccatctcatgcactgtcaactatc
cctccccctattgaccaggctcaggtaactcaaaccagaaaacctgtttatgaagaatta
tccatttgtgggctgaaaaactttggtagtacctgctatattaacagtatggttcaatgc
ctttttagctttggagagtttaagaagatattcctcactgaccaatttacccgttacttg
acgaggtcgccaaccaacacattagctctgtcagttgctggcctttttcgaagtatgaca
gcgaatggaggaatgtctatatctccaacccgattcctgagcgtttgtaactactataga
cctgatttgagaatcccacaagaacagcaagatactcaggaatttctcatgttcatcctg
gataagatccacgaagagttaaactatccatcgatagtgaaattagattttccccatagt
actgcaccgcaacttgatgataaacaatatcgaaaatggttttctgaactgacagagaag
gaaggtgtttctccaatttctaccatgtttcaaggccagctaaagagtaccctgatttgc
aatcaatgtgggaatcaatcaggctcatttactcagttccaaatcttgtctttgcctatt
ccaccttcccatcataatatggtagcagtgaacgattgcatcaatcacttcatccagccc
gaagtattaaggggggacaatgcatggtcatgtcctgagtgtgaaaagagggaaaaaaga
cgtaaggaagaaatgagccaaatgaacaatagtgtcttcaacgatgaggaaaagaaacga
tcaagaaaattattcaagatgttgggaagcaaagaaaagcactcacccaattctaaccac
tccaaggccaatttagtgaaaaccagtcagaaagccctatcatttatatcgttacctcaa
tatctggtaattcacctatcccgatttaatggtttctctcctcaagcatgcaagttagat
gtcacaatagcttatccgctgatattagaaatacccatccacaaagaggatgggtctatg
aatgtggcaagatacaaattatgctctttaattaatcattttggttcgttgaagtctggg
cattacaccgcggtagtcaataagtctgggcatttacataacccatactggtgttacttt
gatgatgaatctgtcaggcctggaatcagtcatggagatttaaacttgggaattaatatg
ctgagctcaagagatgtttacgtcttattctatgaaagaattgcataa

DBGET integrated database retrieval system