KEGG   Pichia pastoris: PAS_chr1-1_0050Help
Entry
PAS_chr1-1_0050   CDS       T01092                                 

Definition
Dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppa  Pichia pastoris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr1-1_0050
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr1-1_0050
   00020 Citrate cycle (TCA cycle)
    PAS_chr1-1_0050
   00620 Pyruvate metabolism
    PAS_chr1-1_0050
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PAS_chr1-1_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(639010..639059,639121..640492)
Genome map
AA seq 473 aa AA seqDB search
MSALTALRVTRPLLRFPAARVSLNLFARGYASKSWPEHTVIDMPALSPTMTQGNIVKWHK
AVGDQLEPGESIAEVETDKASMDFEFQEDGYLAKILLGDGTQEIPVGKPIAVYVEDKADV
EAFESFTIEDAGAPAAAAALAKEEPKEEPKEAATPAPSSEESKSEAKPSSSKQPRPAGSR
IIASPLAKTIALEKGISLKEITGTGPNGRIVAKDVESYKPKSTAAPAAPVSSPAPSTATA
AYQDIPLTNMRKVISKRLTESKQSAPNYIISSSISVSKLLKLRASLNASSNDRYKISVND
LLIKAIAVACKRVPEANAYYLEQEGVIRQFENVDVSVAVATPTGLITPIVFNADSKGLET
ISKTVKDLGKRAKENKLKPEEFQGGTITISNLGMNPSVSFFTSILNPPQSAIIAIGTTEK
KAVPDKGSPHGFVFDDVIQITGTFDHRTVDGAKGGEWVRALKQIVENPLELLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgttaacagcattgagagtgacccgtcccctgttgcgttttcctgcagcaaga
gtctcgttaaacttgtttgctcgtgggtatgcttccaaatcatggcccgaacatactgtc
attgacatgcctgctttgtcgccaactatgacgcagggtaatattgtcaaatggcacaaa
gctgtaggtgaccaattggaacctggtgaatccattgccgaggttgagactgataaagct
tcgatggatttcgaattccaagaggatggttacttggctaaaatcttacttggagacgga
actcaagaaattcctgttggaaagccaattgctgtttatgtcgaagacaaggctgatgtt
gaagccttcgaaagtttcactattgaagacgctggtgccccagctgctgctgctgcccta
gctaaggaagaaccaaaggaagagccaaaagaggctgccacaccagctccttcgagtgaa
gaatctaaatctgaggccaaaccttcgtcttccaaacaacctagacctgctggcagcaga
attatcgcttcccctttggctaagactatcgccttagaaaagggtatctccctcaaggaa
attactggtaccggacccaatggacgaattgtagctaaggatgttgaatcctacaagccc
aagtctactgctgctcccgctgcccctgtttcctctccagctccctccacagccactgct
gcttaccaggatattccacttacaaacatgagaaaggttatttccaagcgtttgacagag
tctaagcaatccgcccctaactacatcatttcctcttctatttcagtatccaaactgttg
aaattgagagcatccttgaacgcttcttctaatgaccgctacaaaatttctgttaatgat
ttactgatcaaggctattgctgttgcctgtaagagagttcctgaggccaatgcctattat
ttggagcaggaaggagttatccgccagtttgagaacgttgatgtttctgttgccgttgcc
actccaacggggttaattacgccaattgttttcaatgctgattccaagggactcgagact
atttccaagactgtgaaggatcttggtaaacgtgcaaaggagaacaagttgaagcctgaa
gaatttcaaggaggaactatcactatctccaaccttggaatgaacccatccgtttccttc
tttacctcaatcctcaacccaccacagagtgctattattgccattggtacgactgagaag
aaggctgttcctgacaagggaagtcctcatggatttgtgtttgacgatgttatccaaatt
acaggaacctttgatcaccgtaccgtagacggagccaagggtggtgagtgggtgcgcgcc
ctgaaacagattgttgagaaccccttggagctccttttataa

DBGET integrated database retrieval system