KEGG   Pichia pastoris: PAS_chr1-1_0051Help
Entry
PAS_chr1-1_0051   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAS_chr1-1_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:640982..642793
Genome map
AA seq 603 aa AA seqDB search
MVMLHLNRKRVRRLNKVPSGSTVPNTKSFTRNDDSDAIILSDSDDHDLLNPFSDYSQIAD
HNDSNIFGDERMLQEDGMLHDLLFPQEQKKNRTYSLPQLPHCKLSYTPTKPNITELVIKE
KIKSVLPEKIPHLSKQSEDLLNYTFDSDTQLNGVRKLSIDSGHAQNPKKRTFSNVSQSSR
NAIVIDVESSDGETEDECDDKNGHYIVKPNSFFANNRFLIKKQIGQGTFGKVVSAYDYKL
KQTVAIKIIKAVPKYREAAKVELRVLSTLRKYDPNNNNHCIQIKECFDFRNHICIVTDLL
RISLYDFMKSNQMLPFPGSHVQAICRQLLRSVAYLHDLNLIHTDLKPENILLLDDSYHRK
SLSESHLIANNPNLSRFSYEKQHVKILQDPSIEIIDFGSAVFEDEFHPNMVSTRHYRAPE
IVLGLGWSFPCDMWSVGCLLVELVTGDVFFNSHEDREHLALMEKVFQKPVDSFMCHKYLQ
QYLRDSSKKPGSQLIHSNHKVNFPNSESSTKSINMVRNAKPMEQTIIEKVPVISQLDMTK
SLASNFEIYDINDEDLRDQYTFWYSFIDLVSKLLQFNPQDRISAKQALEHEWFKLGVLDD
GTL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgctacatctcaatagaaaacgtgttagacgcctcaacaaggttccttccgga
tccactgtccccaataccaaaagtttcactcgaaacgacgattcagatgcaataatactg
tcggatagtgatgatcacgacttgttgaatcctttctcagactattctcagattgcagac
cacaatgattccaatatttttggcgatgaacggatgctccaagaagatggtatgcttcat
gatttgctattccctcaggaacagaagaaaaaccgaacatattccttgcctcagctgcct
cattgcaagttgtcgtacactccgaccaaacctaatataaccgagctcgtaatcaaagag
aaaatcaaaagtgttttgcccgaaaaaattccacatctctcaaaacagtcggaagatttg
ctaaattacacctttgattctgatacccaacttaatggtgtccgaaagctctctattgat
tcggggcatgctcagaacccaaaaaaacgtacgttctctaatgtgagccaatcctcgcgg
aatgctattgttattgacgttgaatcctctgatggtgaaacggaagacgaatgtgatgat
aaaaatggtcattatattgtcaagccgaacagcttttttgccaacaatagatttcttatc
aaaaagcagattggtcaggggacctttggaaaggttgtcagcgcttatgactacaagtta
aaacagactgtggccattaagatcatcaaagcagtacccaagtacagagaggcggctaag
gtggaacttagggtgttgtctacacttcgcaaatatgatcccaataataataaccactgc
atccagatcaaggagtgttttgattttcgaaatcacatctgtattgtaacagatttgttg
cgcatctcactctatgatttcatgaaaagtaatcagatgctgccttttccaggatcgcat
gtacaggcgatatgcagacaactcctaaggtcagttgcttaccttcatgatttaaattta
attcataccgacctcaaaccggaaaatatcctacttttggacgattcataccatcgtaag
agcctttcagagtctcatttgatagccaacaaccccaacttgtccaggttttcgtacgaa
aagcaacatgtcaaaatcttacaggatccctctatcgagatcattgattttgggtcagcg
gtgttcgaggatgaatttcaccccaatatggtttcaaccaggcattatagagctccagag
atcgtgttaggtttgggatggtcgtttccttgcgatatgtggtctgtcggttgtttattg
gtggaactagtaactggtgacgtttttttcaacagtcatgaggatagggagcatttggca
ttaatggagaaggtattccaaaagcctgtagattcctttatgtgtcataaatacctgcaa
caatatctccgtgatagcagcaaaaaacctggttcccaattaatacactccaaccacaag
gtcaattttcccaattcagaaagttcaaccaagtcgatcaatatggtcagaaatgcgaaa
cctatggaacagacgatcatagaaaaggttccagtgatttcgcaattagacatgaccaag
tccttggcttcaaactttgagatttatgacattaatgatgaagatctgagggatcagtat
accttttggtacagtttcatagatttagtctctaaactgcttcagttcaacccacaggat
cgaatttcagccaagcaggccttggaacatgaatggttcaaactaggagttttggatgac
ggaaccttataa

DBGET integrated database retrieval system