KEGG   Komagataella pastoris: PAS_chr1-1_0062Help
Entry
PAS_chr1-1_0062   CDS       T01092                                 

Definition
GTP-cyclohydrolase I, catalyzes the first step in the folic acid biosynthetic pathway
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ppa  Komagataella pastoris
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAS_chr1-1_0062
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PAS_chr1-1_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:661847..662602
Genome map
AA seq 251 aa AA seqDB search
MDDHKTLTQPQPQKRTGHEPFYKRLDTPLNTRPASPYTLNPPIDNDGLSWPSLGARNRLE
ATPEEAEAREKRIASAVKTILTELGEDVEREGLLETPERYARAMLFFTKGYEDNIKDVIK
RAVFEEDHDEMVIVKDIDVYSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLARLAEMYSRR
FQVQERLTKQIAMAVYEILKPRGVAVVMEATHMCMVSRGVQKVGATTTTSCMLGCFRSQQ
KTRDEFLTLIK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccataaaaccctaacgcagccccagcctcaaaaaagaactggccatgagcct
ttttacaagcgactggataccccacttaataccagaccagcctcgccatacacgctgaat
ccccctatcgacaatgacggcttgtcgtggccctcacttggtgcgcggaaccgtttggaa
gctactccagaagaggctgaagccagggaaaagagaatagcctctgctgtaaagacaatt
ctcactgaattgggagaagatgttgaacgggaaggtctacttgaaacaccggaaagatat
gccagagcgatgctatttttcaccaagggttatgaagacaacattaaggatgtaatcaag
agagcagtatttgaagaagatcatgacgaaatggtcatagttaaggacattgacgtttat
tcattgtgtgaacatcacttggtaccatttttcggaaaggttcacatagggtatattccg
aacaaaaaagttttaggattatcaaaactggctaggttggccgaaatgtactccaggagg
tttcaagtccaggagagattgactaaacaaattgctatggctgtatatgagatcctgaaa
ccaaggggggtcgccgtcgtcatggaggccactcatatgtgcatggttagtagaggagtc
caaaaagttggggcaacaacaactactagttgtatgttaggatgtttccgatcccagcaa
aagaccagagacgaattcttgacgttgataaaataa

DBGET integrated database retrieval system