KEGG   Pichia pastoris: PAS_chr1-1_0105Help
Entry
PAS_chr1-1_0105   CDS       T01092                                 

Definition
MAP kinase kinase that plays a pivotal role in the osmosensing signal-transduction pathway
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ppa  Pichia pastoris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAS_chr1-1_0105
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PAS_chr1-1_0105
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PAS_chr1-1_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(747000..748916)
Genome map
AA seq 638 aa AA seqDB search
MTDSVSSSFNNLNLLDDFDEETAELEKLQEEQKPSISRNSSTNRRQQQNGGVNDALRARV
RAFQEKRRTQQDKNETSDDTSSPNSLAESPFSSPGVAPAHADSPKTTWNVKPSPQSPVEF
EPDRYTLPKIKPKVVLPQQPKKSLSEPNTLHRTKPKPNLSLSQLKSYNEVDESKKSQLAQ
QSLRGTPIQPARALPNQQNARVPKTKLSLSERKGLNLNCNLGTNSLKDNSRSMTVGEVLS
KRGQLPRQNKQPPKAQVKPPPPQQQQQPAGGMFANYTKYIDVESGSLNFSGKASVHSKGI
DFSSGSSFRISLDDLEYIEELGRGNYGTVSKVLHKPTNVIMAMKEVRLELDESKFRQILM
ELEILHNCVSNCIVDFYGAFLVEGAVYMCIEYMNGGSLDKIYADVGIPEPQLAYITKCVV
SGLKTLKDKHNIIHRDVKPTNILVNDQGKVKLCDFGVSGNLVASMARTNIGCQSYMAPER
IKSVNPDDISYTVQSDIWSLGLSILEMAKGCYPYPPETYDNIFSQLSAIVDGEAPTLPEG
KFSLEAQDFVAQCLQKDAKLRPTYALLEKHPWLQRYDDDEKNVEDMKIFVTQRLQDIESA
KLVAVDTEKQPNSAPATSAASVFEYKKVPALHRGGLPK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcagtgagttcaagttttaataacttgaacctattagatgattttgacgaa
gaaacagcggagctggaaaaactacaggaagaacagaagccatccatttcccgaaactcg
tccaccaacagaaggcagcaacagaacggtggtgtgaacgatgcattgagagctcgtgtc
agggccttccaagaaaagagacgcacgcagcaagataagaatgagactagtgacgacaca
agctcaccaaactcattagcagagtctcccttttcttctcctggtgtggcgcctgcccat
gcagactctcccaagacgacgtggaatgtcaaaccttcgccacagagtccagtagagttt
gaacccgacagatatactctgccgaagataaaaccgaaagtagtacttccacagcaacct
aaaaagtctttgtcggaaccaaacacgcttcatagaactaaaccgaagccaaatttgtca
ctgtcacaattaaagtcttacaatgaagtggatgaatccaagaaaagccaactagcacag
cagagcctcagaggtactcctatacagcctgcaagagcacttcctaaccaacagaatgct
cgtgtccccaagactaaactttctttatctgaaagaaagggactcaatttgaactgtaat
cttggaacaaattctttgaaggacaacagtcgatcgatgactgtgggagaagtacttagt
aagcgaggtcaacttccaagacagaataagcaacctccgaaggcccaggtaaagccacca
ccacctcaacagcaacaacagcctgctggaggaatgtttgcaaactacactaaatacatt
gatgttgaatctggttcccttaacttttctggaaaagcttctgttcattcaaagggaatt
gatttttcatctggctcttcgttccgaatatcattggacgatttggaatacattgaagaa
ctaggtcgtggtaactacggtacagtcagcaaagtactacacaagccaacaaatgtgatc
atggctatgaaagaagttcggttagagttggatgagtccaagtttcgacagattctaatg
gaactagaaattctgcacaactgtgttagtaactgcattgttgatttttacggagctttc
cttgttgaaggcgctgtatacatgtgcattgaatatatgaacggaggatctctggacaaa
atctacgcagatgttggtattccggaacctcaattagcatatatcactaagtgtgttgta
agtggccttaagactttgaaagataaacacaatattattcacagagatgtcaagcctaca
aacatattagtgaatgatcaaggaaaggtcaaattatgtgactttggagttagcggaaac
ttggttgcttccatggctcgtacaaacatcggatgccaatcctacatggctccagaacgc
atcaaatctgtcaacccagatgatatttcctacacagtacagtccgatatttggtcatta
gggctatccatattagaaatggccaaaggttgttatccttaccctccagaaacatacgat
aatattttttctcaattgagtgctattgtcgatggtgaagcacctacacttccagagggc
aaattctccttagaggctcaggactttgttgcacaatgtcttcaaaaagacgcaaaattg
cgtcccacgtatgccttattggagaaacatccttggctgcaacgttatgatgatgacgaa
aagaacgtggaggacatgaaaatctttgtcacccaacgtctacaagatattgaaagtgcc
aaacttgttgcggtagataccgagaagcaacctaactcagcacccgcaacatctgctgct
tcagtcttcgaatacaagaaagttcctgctctacatagagggggactacctaaatag

DBGET integrated database retrieval system