KEGG   Pichia pastoris: PAS_chr1-1_0111Help
Entry
PAS_chr1-1_0111   CDS       T01092                                 

Definition
Protein involved in negative regulation of transcription of iron regulon
Orthology
K01262  
Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     PAS_chr1-1_0111
Peptidases [BR:ppa01002]
 Metallo Peptidases
  Family M24
   PAS_chr1-1_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(757456..759591)
Genome map
AA seq 711 aa AA seqDB search
MSTHGVQAKLSTYSLRQVHTTPATAPVAGRAPRSCNNCTCSPGLLTRQGRMGSYYAKRLA
NRSKSVALGSASGVSRKTSSVLTVDSSCSEGLKEINTSRRLLELRKKMTEYDLGVYIVPS
EDSHQSEYTGLADQRREFISGFTGSAGVAIITRNVQCMNDDPEGTSYLATDGRYFTQAAN
ELDFNWNLFKLNIPGEISWEEFTVQLAVKMADESGFNVKIGVDPQLITYSEAHLLQGLVD
DVASGEKKGLGIQFVPVTENLIDAIWTKFEPRPVRALMPITLLDEKYSGLDTKEKLAQVK
EALLVLNGQTLVISALDDIAWLLNLRGSEFRYSPLFYAHLIIHDDQVSLYTDDHERFENI
SDYLKERSVTLRPYDKFYDGIKSLPANTVLVTKDCSWEVARQVISPHRVRVIDSPVAIIK
AKKNEVELANAREAHIKDAIALVKYYEWLWQEVGIKGELVDELEAAQKLEFFQSEQDNFI
GQSFQTVSASGSNSAVVHYTPKKEACAVIDPSKVYLCDSGAQYLEGTTDVTRTYHFSNPT
NEQKRNYTLVLKGHIALAKLKFPPGTAGLAIDAIARQHLWTNGLDYTHGTGHGVGSYLNV
HEGPVAIGVRGTVPLEAGHLVTNEPGVYFPGDYGVRLENVMEVKETSDKFLELVPLTLVP
FCRQLIDRKLLTKEEVDWVNHYHAKVYQTLVPRLVRHSPHATWLKRATSSL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcacggagttcaggcaaaattgtcgacttactctttgagacaggttcacacc
actccggcgacagctccagttgctggacgtgccccaagaagttgtaacaactgtacgtgc
tctcctggtttgcttaccagacagggaagaatgggctcgtattacgccaagagattagcc
aacagatctaaatctgttgctttggggtctgcctcaggtgttagtagaaagacttcgtcg
gtcctaactgtggattcctcgtgttcagaaggacttaaggagataaatacaagcagaagg
cttctagagctgagaaagaagatgacagagtacgatcttggtgtatacattgtaccatca
gaggactcacaccaatcagaatacacaggactggcagaccaaagaagagaatttatctcc
ggatttactggatccgctggcgtagctattatcacaagaaatgtacagtgtatgaatgat
gaccccgaaggtacctcttacttggctactgacggcaggtattttacccaagctgccaat
gaactggattttaattggaacttgtttaaactcaatatccccggagaaatatcgtgggaa
gaatttactgtacagctggccgtcaagatggctgatgagtctgggttcaatgttaagata
ggagtagatcctcagttgataacttactctgaggcccatcttctgcagggtttggttgac
gacgttgcttctggcgaaaaaaaagggttggggattcaatttgtccccgttacagaaaat
ttaatagatgctatctggactaagtttgaaccacgtccagttagggcactaatgcctatt
acgctactggacgaaaagtactcgggtttggatactaaagaaaagctggcccaagttaaa
gaagctcttcttgtcttaaacggacaaacgctggtgatcagcgcccttgatgatattgct
tggttactcaacttgcgaggttctgagtttcgatatagtccactgttttatgctcatctg
ataattcatgacgatcaagtatctctctacacggatgatcatgaaaggtttgaaaacatt
tcggattatttgaaggaacgttctgtcactttgagaccttacgacaagttttatgatggc
ataaaaagtctaccagctaatacagtgctagtcaccaaggattgttcctgggaggtggcc
cgccaggtaatatcgccccatcgcgtaagagtaatagactctcctgtggctattatcaag
gccaaaaaaaacgaagttgaactagccaatgctcgtgaagctcacatcaaggatgccatt
gctttagttaaatattatgaatggctatggcaagaagtgggcatcaaaggtgagttagtg
gatgaattagaggctgcgcaaaaactggagtttttccaaagtgaacaagataattttatt
ggccagtcgttccaaacagttagtgcttctgggtccaactcagcagtagttcattacact
ccaaagaaagaggcatgcgcggtcattgatccttccaaagtttatctttgcgacagtggg
gcccaatatctagagggtaccacagatgttactaggacttaccatttttcaaatccaacg
aacgagcaaaagcgcaactacaccttggtcctgaaaggccacatagcgttggcaaagctc
aagtttcctccaggcactgcaggccttgccattgatgctatcgctcgtcaacatctttgg
accaatggactggattacacccacgggacaggccatggtgttggctcgtacctcaatgtc
cacgaggggcctgtggctattggagtccgaggaacggttcccctggaagctggtcattta
gttaccaacgaacccggagtttacttcccaggtgattacggagtgcggctcgaaaatgtc
atggaagtcaaggagacttcggacaagttcttagagctagttccattgaccctagtgcca
ttctgtcgccaactgatagatcgtaaacttctaaccaaggaagaagtggattgggtcaac
cactatcatgccaaagtgtaccagacattagtgccgcgtcttgtgaggcactcgccgcac
gcaacttggctcaagcgcgcaacttcgagtctctag

DBGET integrated database retrieval system