KEGG   Pichia pastoris: PAS_chr1-1_0160Help
Entry
PAS_chr1-1_0160   CDS       T01092                                 

Definition
Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ppa  Pichia pastoris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAS_chr1-1_0160
Enzymes [BR:ppa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAS_chr1-1_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(856216..857325)
Genome map
AA seq 369 aa AA seqDB search
MKILSALLLLFTLAFAEVIELTNKNFDDVVLKSGKYTLVKFYADWCSHCKRMNPEYEKLA
EELKPKSDLIQIAAIDANKYSKYMKVYDIDGFPTMKLFTPKDISHPIEFSGSRDSESFLN
FLESTTGLKLKKKAEVNEPSLVQSIDDSTIDDLVGKDRFIAVTASWCGYCKRLHPEWEKL
AKAFGNDDIVIGNVVTDVVEGENIKAKYKVQSFPTILYFTAGSDEPIRYESPDRTVEGLV
KFVNEQAGLFRDPDGTLNFNAGLIPGVSDKLTNYIKEKDQSLLESTLDLLSNHEHIKDKF
SVKYHKKVIEKLLKGENEFLNNEVERLSKMLNTKLSANNSDSVIKRLNILRNFIEAKTES
KPQLLHQEL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaagtgcattgcttcttctttttacgttggcctttgctgaggtcattgag
ctgaccaacaagaactttgatgacgtggttctaaagtccggaaagtacaccttagtgaag
ttttatgccgattggtgttcgcattgcaagcgaatgaatccagagtatgaaaagctggcc
gaagaactgaagccaaagagtgatctgatccagattgccgccattgatgctaacaaatac
tcaaagtacatgaaggtgtacgatattgatggatttccgacgatgaaattgttcacaccc
aaggacatatctcatccgatcgaattttctggatcaagagacagtgaaagctttttgaac
tttttggagtcaactactggtttgaagttgaagaagaaggcggaagtaaatgagccttcg
ttagttcaatcaattgatgattcaacaatagatgaccttgttgggaaggacaggtttatt
gcagttactgcttcgtggtgtggatattgcaaaagattgcatcctgaatgggagaagtta
gccaaagcttttggcaatgacgatattgtcatcggaaacgttgttaccgatgttgtggaa
ggtgagaatattaaggcgaagtataaagttcaatctttcccgactatcctgtacttcaca
gcaggctcagatgaaccaataagatatgaatctccagatagaactgttgaaggtttggtt
aaatttgtcaatgaacaagctggcttatttcgtgatccagatggaactttgaatttcaac
gccggtctaattccaggagtgagtgataaacttaccaattacattaaggaaaaagaccaa
agtttattggagtcaacgttagacttgctaagcaaccatgaacatatcaaggacaaattc
agtgtcaaataccacaagaaggtcatagaaaagttgttgaagggagagaatgaattcctc
aacaatgaagttgagaggctatcaaaaatgctgaatacaaagctatcggcaaacaattca
gactctgtgattaaaagactgaatatcttgcgcaattttattgaggccaaaactgagtca
aaaccccagttattacaccaagagctataa

DBGET integrated database retrieval system