KEGG   Pichia pastoris: PAS_chr1-1_0172Help
Entry
PAS_chr1-1_0172   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K03963  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
ppa  Pichia pastoris
Pathway
Oxidative phosphorylation
Metabolic pathways
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ppa00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:877062..877409
Genome map
AA seq 115 aa AA seqDB search
MSGEESAKDIGQLREGKLYPLNYSHSHTNETIKLTLIVSHEEMKQNKIPLAYRDRCARLL
VPLNKCRKEGWYMPWNCVQERHDYEQCQYLDFKRRVKELEEIKKQRDAADASADL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggaggagtcggcgaaggacattggccaattgagagagggaaaactttatcct
ttgaactattcacattcgcacaccaatgagaccattaaactaacattgatagtttcccat
gaggaaatgaaacagaacaagattcctcttgcctacagagacagatgtgccagactgttg
gttcctctcaacaagtgtaggaaggagggatggtatatgccttggaattgtgttcaagag
agacacgactacgaacaatgtcagtatctggatttcaagagaagggtcaaggaattggag
gagatcaagaaacagagagacgctgcggatgcctcagcagatctttga

DBGET integrated database retrieval system