KEGG   Pichia pastoris: PAS_chr1-1_0202Help
Entry
PAS_chr1-1_0202   CDS       T01092                                 

Definition
Subunit of the RNA polymerase II mediator complex
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     PAS_chr1-1_0202
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   PAS_chr1-1_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(950205..951569)
Genome map
AA seq 454 aa AA seqDB search
MSWKLTNQLRDKIYRYARFPPTGVSLRQMVQFGPKPSAGTLFHASQFVVEELPIRLAHRV
KELEELPDDLNQMPSIQRVRDWYARSFDELTSLAAPDISDELRNLLYEDGHNHLYQPEMN
EMPPNNIQVQHSDTSFDDDGLVISNRHHHSKATSASQNQSSNKKKYYLSCPSNVVYPKEV
YEYNKLVADTLKTIKKRHDATVPTVARGVQEWKHAKNQMSIESNIQSFLDRFYLSRIGIR
ILIGQTIALNQDIGNDNYVGIICLNTNVADVARDAIDSARFTCEEHYGLFEAPKVQLYCP
EDLTFMYVPGHLIHMLFETLKNSLRATVEHHIQLNPGVDIEDIEFPPVKIIVAEGNEDIT
IKISDEGGGIPRSAISLIWTYLYTTVEEMPSLDHDTDAKADFRAPMSGLGFGLPLSRLYA
RYFGGDLKLISMENYGTDVYLHLNRLSSSSEPLP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggaagttgaccaaccaattgcgagataagatctataggtatgcgaggttccct
cctactggtgtctcgctgaggcagatggttcaatttggacccaagccctccgctggtact
ttgttccacgcgtcccaatttgtagtagaagagctacctatacgtcttgcccatcgtgtg
aaagagctagaagaacttccagatgatttaaaccaaatgccatcgatacagagggtcagg
gattggtatgcaagaagtttcgatgagttgacctcgctggccgcccccgacatcagtgac
gaactgcgtaacttgctttatgaggatggtcacaaccacctttatcagccagaaatgaat
gaaatgcctcctaataacatccaagtgcaacattccgatacgtcgtttgacgatgacggc
ttggtcatcagcaacagacaccaccactctaaagcaactagtgcttcacagaaccaaagc
tccaacaaaaagaaatactatctaagctgcccttccaatgtcgtgtatccaaaagaggtc
tatgagtacaacaagctggtcgcagataccctgaaaaccatcaagaagagacacgatgcg
actgtgcctactgtggccagaggagttcaagaatggaaacatgcaaagaatcaaatgagt
atcgagtcgaatatacagtcatttttagatcgattttatttatcccggattggaataagg
atactgatcggacagaccatcgctctgaaccaggatattggcaacgacaactacgtgggg
ataatctgtttgaatacgaacgtggcagacgttgcacgggacgcaatagatagtgcccgg
tttacgtgcgaggagcattatggattatttgaggctcctaaggttcaattgtactgccct
gaagatctcactttcatgtacgttccaggccatctcatccacatgctatttgaaaccttg
aaaaattcgttgagggccaccgtagaacaccatatccaattgaatcccggcgtggatatt
gaggatattgaatttccccctgtaaagatcatagtcgcagagggaaatgaggatattaca
atcaagatatccgacgaaggaggaggaatccctcgttctgcaatttccttgatatggact
tatctttacaccacagtggaagagatgccaagtctagaccatgataccgatgcaaaggct
gatttcagagctcccatgtctggcttaggatttggacttccactcagcaggctttatgcc
cgttactttggaggtgatcttaagttgattagcatggagaactacggaaccgatgtttat
ctgcatttgaatcggctgtcctcctcttcggagcctctcccataa

DBGET integrated database retrieval system