KEGG   Pichia pastoris: PAS_chr1-1_0358Help
Entry
PAS_chr1-1_0358   CDS       T01092                                 

Definition
Ceramide synthase component, involved in synthesis of ceramide
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ppa  Pichia pastoris
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PAS_chr1-1_0358
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PAS_chr1-1_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1224647..1225858
Genome map
AA seq 403 aa AA seqDB search
MSKEEKTRRRRASSIGNINLGDNAVPSLTTRKSNAQQRKSSSARINLINKKGSSDWGLVK
KIGLSLVELSSRHTWLPFLVSLVAIHGSYLLSNNHTPSNPLHKFVDLSYKIEGTNPPMYG
KGWKDFCFVFYFMIFFSFYREFLMQALLKPLASKLGITRESKVRRFMEQSYSMCYYGFSG
PLGLYIMAGMPLWYFNTTEFYITYPHKSHEYLFKYYYLGQAAFWSQQAVVLMLQLEKPRK
DFKELVIHHIITIALIYCSYRFHFTWMGLAVYITMDISDFFLALSKTLNYVDSAYTGPAF
MFFVGVWFYLRHWLNVKILWSVLTEFRTVGPFELNWITQQYKCWISQPIVFSLIFALQLV
NLYWFVLILRILYRHIFLDVTKDERSDDESEEEAQVEPSKKEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaggaaaagacaagacgtcgaagagcgtcatccattggaaacataaaccta
ggtgacaatgcagttccttctttgactacccgaaagtcgaatgctcagcagagaaagtct
agctccgcccgtattaatttaatcaacaagaagggaagttccgattggggtttagttaaa
aaaattggactttccttggtcgaactgagctcgcgtcacacatggttgccatttttggtt
tctttggttgccatacatggctcgtatctgttatctaataaccacactccatccaatcca
ttgcacaagttcgttgatctttcatataaaatcgaaggaactaaccctcccatgtatggc
aaaggatggaaagacttctgctttgtgttttacttcatgattttcttcagtttctaccgt
gaatttttgatgcaagcgttactgaaacctttggccagtaagttgggtatcacaagagag
tctaaagtcagaagattcatggaacagtcttattcaatgtgctactatggattttctggg
cccttgggtctatatatcatggcaggtatgcccttgtggtacttcaacacgacagaattc
tatattacttaccctcacaaaagtcatgaatatctgttcaagtactattatttgggtcaa
gccgctttctggtctcaacaagctgttgtcttgatgctacaattggaaaagccgagaaaa
gatttcaaggagctggttattcaccacattatcaccattgcactgatttactgtagttac
agatttcatttcacttggatggggcttgcagtctacattaccatggacatctctgacttc
ttcctggctctttccaagaccctgaactatgttgattcagcttacactggtcccgcgttc
atgttctttgtgggtgtctggttctacttgcgccattggctcaatgtcaagatcctttgg
tctgtattgactgaattccgtaccgtaggtccatttgaattgaactggatcacacagcaa
tacaaatgttggatttcacaaccaattgtattttcattgatttttgccttgcagctggtg
aatctgtactggtttgtgttaattctccggattttgtaccgtcacatctttttagatgtt
accaaagacgaaagatccgacgatgaaagcgaagaagaagcccaagtagaaccctccaag
aaggaagaatag

DBGET integrated database retrieval system