KEGG   Pichia pastoris: PAS_chr1-3_0094Help
Entry
PAS_chr1-3_0094   CDS       T01092                                 

Definition
Dihydrolipoyl transsuccinylase, component of the mitochondrial alpha-ketoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppa  Pichia pastoris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr1-3_0094
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAS_chr1-3_0094
  Amino acid metabolism
   00310 Lysine degradation
    PAS_chr1-3_0094
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAS_chr1-3_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(177343..178668)
Genome map
AA seq 441 aa AA seqDB search
MFSKSARLVKQVKVSLPVTPMASRRFLQTAPKFMGAASIRNPRLIAPRSLQLIRFQSQTV
KVPDMAESITEGTLSQFLKKVGDYVAADEVVATIETDKIDVEVNSPVAGTITELLAAEED
TVEVGQDLFKVEPGAKPEGAAAAPKAEEPGEKKTEEAAPASSTEKKEEPPAAAWAPPPKT
AEPAAPAKKETPKQTKEETSAPKAGTFSRNEERIKMNRMRLRIAERLKESQDTNASLTTF
NEVDMTSLMEMRKLYKDEFLEKTGIKFGFMGAFSRASALAAKDIPSVNAAIENNDTIVYR
DYMDISIAVATPKGLVTPVVRNVESLSVLDIEKEISNLGKKARDGKLTLEDMAGGTFTIS
NGGVFGSLYGTPIINIPQTAVLGLHGVKQRPVVVAGGKIEARPMMYLALTYDHRMMDGRE
GVIFLKTIKELIEDPRKMLLM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaaatcagctcgcttagtcaagcaggttaaggtgtccttaccagtgacccca
atggcctctagaagattccttcaaactgcacccaaatttatgggcgctgcttctatccgc
aacccacgtctcattgcccccaggtctcttcagttgattagatttcaatcacaaactgtg
aaagttccagatatggccgagtctattacagagggaaccctgtcacagttcttaaagaaa
gtaggtgattatgtggctgccgatgaggtggttgctaccatcgaaacggataagatcgat
gttgaggtcaattccccagtggctggtaccataactgaacttttagctgccgaggaagat
accgtcgaggttggacaggatctgttcaaggttgaacctggtgccaaacctgaaggtgcc
gccgcagccccaaaagctgaagagcctggtgagaagaagactgaagaggcagccccagct
tcatctacggaaaagaaggaggaaccccctgccgcagcttgggcccctcccccaaaaact
gctgaaccagcagctccagcaaaaaaggaaactccaaaacagactaaggaggagacttct
gccccaaaagctggcactttctcaagaaatgaagagcgaattaaaatgaaccgtatgaga
ctacgtattgcagagagactaaaggaatctcaagacactaacgcttccttgactactttt
aacgaggtggacatgacctccttaatggaaatgcgtaagttgtacaaggatgaatttttg
gagaagactggcattaaattcggattcatgggtgccttttcccgtgcttccgcccttgcc
gccaaggacattccatctgttaacgctgcaattgaaaacaatgataccattgtctaccgt
gattacatggacatttccattgccgtggctactccaaagggacttgttacgccggtggta
cgtaacgtcgaatctttatctgttttggatatagagaaagagatctccaatttgggtaag
aaagctagagatggtaagttaactctagaggacatggccggtggaacctttacaatctcc
aacggaggtgtatttggctcgttatacggaacaccaatcatcaatattcctcagactgct
gttctgggtctacacggagttaaacagaggccagttgttgttgccggaggtaagattgag
gcccgtccaatgatgtaccttgctttgacttacgatcaccgtatgatggatggtagagag
ggtgttattttcctcaagacgatcaaggagctcattgaagatccacgcaagatgttgctc
atgtaa

DBGET integrated database retrieval system