KEGG   Pichia pastoris: PAS_chr1-3_0108Help
Entry
PAS_chr1-3_0108   CDS       T01092                                 

Definition
Ubiquitin-specific protease that deubiquitinates ubiquitin-protein moieties
Orthology
K11873  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(208598..210637)
Genome map
AA seq 679 aa AA seqDB search
MSNQQERTLGPLVERILAQPVEFQPAKRPDSVTVKPSSYVSFGSVSAAPLTQTLKRGSSP
DPKSGGDKSKNLKPKPKSMAEAIAAYTQKKLLPKVLSTTENAPLDDDLGEDLEDLNHKSS
ESPSVDSDAHQDTDFKASKEEQEEHEVDKEDDEDDDNDDGDEDEDSDYHTAESSDGLQSE
DSGSDAETNLDHDVPSATSDTGSDKEDNGSTNSNSSSATAYLSEVESLKRDSALKQATPP
TSPENEEEIEAKRKVFATEADFYQLNELYDDRGSNNSTRICKNWRQMSKSRPLGLLNHGV
TCYMNSAVQALIHIPAFQHYLNDVCRNKYQSVIAPNSVTKTLAETSAKMWQLEKSPGRNT
PLHINPKKLIRRLEEINCMMSKWQQEDSHEYLMSLMSRLQEDSTPKGVKLRASIIHDIFG
GSLHQKVTCKNCGHISETQQDFYDLSLSLDNRKRKSASETDHVRTANTEANSDSTNEVEN
SSTAGNVQHDVQQSTGSRYSIERSIKDFFSSELIKTDKKDKTGYVCEKCNKRTNAVKVST
IDTAPESLIIHLKRFRYDGNSNSSTKVKTGVSYPETLEMTEYTTTNFPARYKLLSVILHE
GRSVSSGHYICYSRQPDNTWASYDDEYVNTMPEKQALKDPSAYVLVYQRITHKSILEPSS
ATSLKRSKPSSPHSKRTKR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcagcaggagagaacgttagggcccttggtggaaaggattttggctcagcca
gtcgaatttcagccagccaagcgtccagattctgtaaccgttaaaccatctagctacgtt
tcatttggtagcgtgtcggccgcgccactgacccaaactctcaagcgaggttcttcgcca
gaccccaaaagtggtggggacaaatccaagaatctgaaacccaaaccaaaatctatggct
gaagctatagcagcctacacgcagaagaaactgttgcccaaggtattaagcaccactgag
aatgcaccattggatgatgatctgggagaagatctggaagacttgaaccacaaaagttcg
gaatctccttctgttgatagcgatgcgcaccaggacaccgatttcaaggccagcaaggaa
gaacaagaagagcacgaagtagacaaagaggatgatgaggacgatgacaatgatgatggt
gatgaggacgaggatagtgattatcataccgctgaaagctcggatggactgcaatctgag
gattccggttcagatgccgaaaccaatcttgatcacgatgtgccatcggccactagtgat
actggttcagacaaagaggacaatggtagtaccaactctaactccagctcagctactgca
tatttatcagaagttgaatccctgaagagagactccgcactaaaacaggcaactccacct
acatctccagaaaacgaagaagagatcgaggcaaaaagaaaagtctttgctaccgaggcc
gatttttatcagttgaatgagttatatgacgacagagggtccaacaattccactcgtata
tgcaagaattggagacaaatgtcaaaatctcgtcctttaggtctgttaaaccacggagtt
acatgttacatgaactctgcagttcaagctctgattcatattcctgctttccagcactat
cttaacgacgtctgccgtaataaataccaatcggttattgctccaaatagtgttactaag
acattggcagaaacatccgctaagatgtggcaattggaaaaatcccccggacgcaacacg
cctctccatataaatccaaagaaactcattcgaaggttagaagagatcaattgcatgatg
tcaaaatggcaacaagaagactctcacgagtatttgatgtctttaatgtcaagactacag
gaagattccactcctaaaggtgttaaacttagagcgagtatcattcatgatatttttgga
ggttcattgcaccaaaaagttacctgcaagaattgcggccacatcagcgaaactcaacaa
gatttctatgatctttcactcagtcttgataaccgtaaacgcaagtctgctagtgaaact
gaccatgttcgcactgccaacacggaagccaattctgattccaccaatgaagtagaaaat
tcaagcacagccggtaacgttcagcatgatgtccaacaatccactggatcccgatattct
attgaacgttcaataaaggatttcttctcctcagaattgatcaaaaccgataagaaagac
aagactggttacgtttgcgaaaaatgcaataaacgaaccaacgctgtgaaagtttcaact
attgatactgcacccgagtcgcttataattcatcttaaacgatttcgttacgatgggaac
tctaactcgtccacaaaggtcaagactggcgtctcataccctgaaaccctagaaatgacg
gaatacactacaaccaactttcctgctcgttataaattactttctgtgattcttcatgag
ggccgttccgtttcttcagggcattacatttgttattccagacaaccagacaatacatgg
gctagctacgacgacgaatacgtcaacacaatgcctgaaaaacaggccctcaaagatcct
tcagcctatgtgttggtttatcaacggatcacccacaagagcattttagaaccttccagt
gcgacatcgctcaagcgttctaaaccatcctcccctcattccaagagaactaagcgctga

DBGET integrated database retrieval system