KEGG   Pichia pastoris: PAS_chr1-3_0122Help
Entry
PAS_chr1-3_0122   CDS       T01092                                 

Definition
UDP-glucose pyrophosphorylase (UGPase), catalyses the reversible formation of UDP-Glc
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppa  Pichia pastoris
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ppa00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:229631..231142
Genome map
AA seq 503 aa AA seqDB search
MSAYQSPKKHVKTQSAYAFDNTTTSIAASQMRNVLNTLVDSVHAADEHTRERFENEMDTF
FGLFRRYLADKASGSTLDWDKINSPTKEEVVKYQDLKSVENTDNLSKLAVLKLNGGLGTS
MGCVGPKSVIEVREGQSFLDLSVRQIEYLNRTFDTDVPLLLMNSFNTDDDTHHLIQKYQG
HRIRIRTFNQSRYPRIFKDSLLPVPQSYDDSLEAWYPPGHGDLFESLVASGELDVLLQQG
KEILFVSNGDNLGATVDTKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEI
AQVPKEHVEEFKSIKKFTNFNTNNLWINLKAIKRLVESDSIKVEIIPNNKTIRVGSQEVN
VVQLETAVGAAIRHFRNAHGVVVSRSRFLPVKTCSDLLLVKSDLFYLEHGSLKIDPARFG
AAPLIKLGSHFKKVKEFQDRIPHMPKILELDHLTVTGNVQFGKGVQLKGTVIIVCSDGQR
IDIPNGSILENVVVTGNLTILEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatcaatctcctaagaaacacgtcaagactcagtccgcctatgctttcgac
aacaccacaacaagcattgctgcctctcaaatgagaaacgttctcaacaccttggtcgac
tctgtgcatgcagccgatgagcacacaagggagcgtttcgaaaatgagatggacactttc
ttcgggttgtttcgtcgctacttagctgacaaggcctccggttctactttggactgggac
aaaatcaactcccccaccaaagaggaagtcgttaagtaccaagatcttaagagcgttgaa
aacactgacaacttgtccaagcttgccgtgctcaagttgaatggtggtctgggaacctca
atgggttgtgttggaccgaaatccgttatcgaagttcgtgagggacaatccttcctggac
ctttccgttcgtcagattgaatacctcaacagaactttcgacaccgatgttccattgcta
ttgatgaactctttcaacacggatgatgacactcatcatttgatccagaagtaccagggt
catcgtattcgtatccgcacattcaaccaatctcgatatccacgtattttcaaagattca
ctgcttcctgttccacagtcttatgatgattctttggaagcctggtatcctccaggtcac
ggtgatctctttgaatctctggtagcttcaggtgagttagatgtactattgcagcaaggt
aaggaaatcttatttgtctccaacggtgataacttaggagcaactgtggacaccaagatt
ttgaaccatatgattgaaacaggtgctgaatacattatggagcttacggataaaactagg
gctgatgttaagggtggtactttgatctcgtacgatggtcaagtccgtctattggagatt
gcccaagttccaaaagagcatgttgaagagtttaaatctatcaagaaatttactaacttc
aataccaataacttgtggatcaatttgaaggctatcaagcgtctggtagaatccgattca
atcaaagtggaaataattccaaacaacaagactatccgcgttggctctcaggaggttaac
gttgtgcaattggagactgctgttggtgccgctatcagacatttccgcaatgcacacggt
gtggtggtatcaagatctcgtttcttgccagttaaaacatgttcagatctactgctagtc
aaatctgacctgttctatcttgaacatggttcactaaaaatagatcctgcccgttttggg
gctgctccacttattaagttgggttctcactttaagaaggtcaaggagttccaggatcgg
attccccatatgcctaaaatcttggaattggatcaccttacggttaccggtaatgttcag
tttggtaaaggagtccagctaaaaggaactgtcattatcgtgtgttctgacggtcaaaga
attgacatccctaacggatcaattcttgaaaatgttgttgttacaggtaaccttactatt
ttggagcattag

DBGET integrated database retrieval system