KEGG   Komagataella pastoris: PAS_chr1-3_0148Help
Entry
PAS_chr1-3_0148   CDS       T01092                                 

Definition
Subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C)
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ppa  Komagataella pastoris
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PAS_chr1-3_0148
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PAS_chr1-3_0148
   04113 Meiosis - yeast
    PAS_chr1-3_0148
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PAS_chr1-3_0148
Ubiquitin system [BR:ppa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     PAS_chr1-3_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(273407..275488)
Genome map
AA seq 693 aa AA seqDB search
MSVQEYNIQKLRGIVYNCLDNEQLDSAQLNVEILCAQNPANLDSIHLHGLVLYRRGLYKS
AYNLTANKMHMGCAYVFALCALKLEHPQEGIYVLQKILDTIREEGISEESMESNLGKNEN
QRSVLPDIPSFYNLLGKLYASMDDDVNTVVCYSKALELNPFLFEAFEQLSKLGAKIKIGK
VYKPTSTFSMNPPAGSELFESIAPDTSVELKQPEDSKPKGRSLFGRSNIMGTPEFSKNKV
KNLTTPKVRELKLPEAPTRKTRSSVTSDAFKPPPANTSSSFPRRSNRLSASKVTSRLLMQ
PISGLGTPSTYDNDNTTHMDSIKTNKDSWLKRSYNFSNMPPAPNNNSDFRNFNEVTSENE
LIVLYGRIARAYKAFCQYDCFKAIRLFTSLPEHVVDMPWVLAKLGRLHFEIVNYEQSEFY
FQKLRQIDRTRVEDMEYYSTLLWHLHKESELSYLSHELYQIDKYAPQTWVTIGNLFSLNR
DNEEAVRCFQKATQLDQNFAYAYTLQGHEHVANDSFENAFESFRYALSIDKRHYNALYGL
GMVHLKLGDFTKAEFHFRKAIDINPVNVILTCCVGMVLEKLGKRELSLKQYDFACKLQPL
SMLALFKKAQVLLALQQYDLALKDFEKLQKLAPDEASVHFLLGELYKQLGRKSDAIKQLT
IALNLDPKGSHVVKESLEGIQTIDTIDEEMNDH
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccaagaatacaacattcagaagctgcggggtatcgtgtataattgcctagat
aatgaacagctggattcggcgcaactgaacgtggagattttgtgtgctcaaaatcctgct
aaccttgattcgatacatcttcacgggcttgttttgtatcgaaggggtctctacaagtct
gcctacaatctaactgctaataaaatgcacatgggatgtgcttatgtttttgcattgtgt
gcgttaaagttggaacatccccaagaaggaatttatgtgctccagaaaatactggatact
atcagagaagaaggcatctcagaagaatctatggaatccaatttgggaaagaatgaaaat
caacggagtgtgttaccagatatcccttctttttataacttgctgggcaagttgtatgcc
tctatggatgacgatgtcaatactgtggtgtgctactccaaggctttagaactgaaccct
tttctttttgaagcttttgagcaattgtctaagttaggggccaagatcaaaattggcaaa
gtatacaaacccacgtctaccttctcgatgaatccgccagctggtagtgaattatttgag
agcatagcacctgatacttcggtggaactaaaacagccagaagactccaaacctaagggg
cgatctcttttcggaagatctaatattatgggcactccggagttttccaagaataaagtc
aagaacctgactaccccaaaagtacgagagctcaagctccctgaagcacctacaagaaag
actagaagttctgtaacttcagatgcattcaaaccgccgccagcaaatacatcaagctca
tttccaagaagatcgaatagactttcagcttccaaggttacgtctcgtttgctgatgcaa
cctatttctggcttaggtaccccttcaacttatgacaacgataatacaactcacatggat
agcatcaaaactaacaaagactcatggttgaagcgatcttataatttttctaacatgccc
cctgctccaaacaataatagtgacttccgtaattttaatgaggttacgagtgaaaacgag
ttgattgttctttacggacgaattgcaagagcttacaaggcattttgtcaatacgattgc
ttcaaagctatcagactcttcacgtctttaccggagcacgtcgttgatatgccctgggtt
ctggccaagctaggaaggttgcattttgagattgtcaactatgaacaatctgagttctat
tttcaaaaactgagacaaattgaccgaacgagggttgaagatatggagtattactctacg
cttttgtggcatctgcacaaagaatctgagttgagctatctttctcatgagctctatcaa
atagacaaatatgctcctcaaacatgggtcacgattggtaaccttttctcattgaatagg
gacaacgaggaggccgttagatgtttccaaaaagcaacccagttagaccagaattttgca
tatgcttatactcttcaaggacatgaacatgttgcaaatgattcttttgagaatgcattt
gaaagctttagatatgctctatctattgacaaacgacattacaatgcattatatggctta
ggaatggtccatctcaaacttggagactttacaaaggcagaatttcactttaggaaagct
attgatatcaatcctgtaaacgtcatactaacttgttgtgtaggtatggtacttgagaag
ttaggaaaacgggagctttctttgaagcagtacgattttgcatgcaaattgcaacctttg
tctatgctagcacttttcaagaaagctcaagttctcttagctctccaacaatacgactta
gctctcaaagactttgagaaactgcaaaagcttgctccagatgaagcaagtgttcacttc
cttcttggagaactttacaaacaactggggagaaaatcagacgccatcaaacagctgact
attgcattgaatcttgatcctaagggctctcacgtcgtgaaagaatcactagagggaatc
caaaccatagataccatcgacgaagagatgaacgaccattga

DBGET integrated database retrieval system