KEGG   Pichia pastoris: PAS_chr1-3_0232Help
Entry
PAS_chr1-3_0232   CDS       T01092                                 

Definition
Mitogen-activated protein kinase involved in osmoregulation via three independent osmosensors
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ppa  Pichia pastoris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAS_chr1-3_0232
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAS_chr1-3_0232
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   PAS_chr1-3_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(434139..434161,434216..435239)
Genome map
AA seq 348 aa AA seqDB search
MSQEKFTRTQIFGTIFETTARYDELNPVGMGAFGLVCSAKDKLTEQQVAIKKIMKPFSTP
VLAKRTYRELKLLNHLRHENLITLTDIFLSPLEDIYIVTELQGTDLHRLLTSRPLEKQFI
QYFLYQILRALKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDHQMTGYVSTRY
YRAPEIMLTWQKYDTEVDIWSAGCIFAEMIEGKPLFPGKDHINQFSIITELLGSPPTDVI
DTICSENTLRFVQSLPHREPVPLIERFQGVEPVAIDLLEKMLVFDARKRITAEESLAHEY
LEPYHDPTDEPVAAEKFDWSFNDADLPVDTWRVMMYSEILDFHQVEDQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagagaagttcacaagaactcagatatttggtacgatctttgagaccaccgct
aggtacgatgagttgaacccagtgggtatgggcgcctttggtttagtctgttctgccaag
gacaagcttacggagcaacaagtagcaattaagaagattatgaaaccattttccactcct
gttttggccaaaagaacttacagagagttgaagttgctaaatcacctgagacatgagaat
ttgattacactaacagacatctttctatctcctcttgaggatatttatattgtgacggag
ttacaaggaacggacttgcatcgattgttgacaagcaggccgttggaaaaacagttcata
cagtacttcctgtaccagatattgagagcactgaaatatgtgcactcggccggagttatc
catagagacttgaaaccaagcaacattcttatcaacgaaaactgtgaccttaaaatatgt
gattttggactggctcgtatccaggaccatcagatgaccggttacgtttctacaagatat
taccgtgccccagagatcatgttgacatggcagaaatatgatacagaggtcgatatatgg
agtgcagggtgcattttcgccgagatgattgaaggaaagcctttgtttcctggtaaagat
catatcaatcaattcagtattattacagagttacttggatctccacccactgacgttatt
gatactatttgctctgaaaacacactaaggtttgtccagagtctgcctcatagggaaccg
gtgcctttaatagaacggttccagggagtggagcctgttgctattgatttgctggaaaaa
atgctggtatttgatgcacgtaagagaatcactgcagaggagtctctggcccacgagtac
ttggagccctaccatgaccctactgatgagcctgtggcagcagagaagttcgactggtcg
ttcaacgatgccgacttacctgtagacacttggcgagtaatgatgtacagtgagatttta
gacttccatcaagttgaggatcaatga

DBGET integrated database retrieval system