KEGG   Pichia pastoris: PAS_chr1-3_0261Help
Entry
PAS_chr1-3_0261   CDS       T01092                                 

Definition
Ubiquitin isopeptidase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAS_chr1-3_0261
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAS_chr1-3_0261
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr1-3_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(477935..480061)
Genome map
AA seq 708 aa AA seqDB search
MTCQSVEELDAIVESKLREVDNKVSNGNVDFIKQYLIQAMNYYDKYRSEIKKIGPTEKNP
KYYCFQEAAYVNYKASQALLRERIPKLPGFGGYKSAYSKIYRELIEMVEGQEHEIAQIKS
GLRKNFCDDTLVLRLRSLKSPSATQPKSLPDSTPTSQFKPKPSKPFSITINEEYISVDQL
SRLLKTNPNDILLIDLRSRQEYDVYHIEDGSGVDMSICIEPMSIRNGYTAEDLYQLSMAV
NPDYERRLFKNRSQYELLVCYGNYDNEATVQMFMTIMNKDTSLKRRSVYLKSGIKGWNQD
LSFQDSKPNGYLTSTTDYFSNTPKHTITPKSSKSSSKPTLKTTVNSGPAHTVGINNLGNT
CYMNCILQCLLESDKFVSFFLQGDYKKHININSRLGSRGILATGFHLLVLLISRSSGKTV
TPSSFAKDVSTVNKNFKLGEQQDCFEFLDFLLDSLHEDLNECGNEPPIAELTPEEEKLRE
ALPIRIASTIEWERYLKNNFSIVEDVFQGQYFSRLECTVCKSTSTTYNSFSSLSLPIPLD
RQNVTLDDCFQAFCSVEELNGDDRWHCPSCKKKQVAFKKLGISRLPSVLIVHFKRFQVKW
ETGHIIKIDKFISYPFKLSMDKYWPKAQSEEELRNLEKLPSRNQNPPFNYRLTGVANHFG
TRTSSGHYTSYVQKGGQWYYFDDSAVTSNVDRHKIVNGNAYVLFYRRS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgacctgccaaagtgtagaagagctggatgctattgttgaatcaaagcttagggaggtt
gataataaagtttcgaacggaaatgttgacttcatcaaacaatatctgattcaggcgatg
aactattatgacaagtatagatctgaaatcaaaaaaattggacccacagaaaagaaccct
aaatactattgttttcaagaggcagcgtatgttaactacaaagcttcccaagctttacta
agagagagaatacccaagctgcctggctttggaggatataaatctgcgtattcaaaaatc
tatcgtgaactgatagaaatggtagaggggcaagaacatgagattgcccagataaaaagc
ggcttaaggaaaaacttttgtgatgatacattagttcttcgactgagaagtttaaaatca
ccatctgctactcagcccaaaagtttaccggattctacacccacttcacaatttaaacca
aaaccttcaaagccttttagtatcacaatcaatgaggaatacatttcggttgaccaattg
tcacgccttcttaaaacgaacccgaatgacatactcctcattgatctacggtctcgtcaa
gagtacgacgtgtatcacattgaagatggctccggggtggacatgtcaatatgtatagaa
ccaatgagtatcagaaacggatacacagcagaggatctttatcaactttcaatggccgtc
aatccagattatgaaaggagattgttcaagaatcggtctcagtatgaactgttggtatgt
tatggtaattatgacaacgaggctactgttcaaatgttcatgactatcatgaataaagat
acttccctcaagaggcggagcgtctatttgaaatccggaattaagggctggaatcaggat
ctgagttttcaagattcgaaaccgaatgggtacttaactagtacgactgactacttcagt
aacactccgaaacacacaattacgcccaaatcatcaaaatcaagttcaaaacctacttta
aaaactactgtcaactctgggcctgcccacactgttgggatcaataatctaggaaataca
tgttacatgaattgcatacttcaatgcctattagaaagtgataagtttgtttcatttttt
ttacaaggcgattataagaaacatatcaatattaatagccgattaggctcgagaggtata
ttggctacaggatttcatttgttagtgctattaatatccagatcatctggtaaaacagtg
actccttcttcatttgccaaagatgtttcaacagtgaataagaattttaagttaggagag
caacaggattgttttgaatttttagattttctcctggatagtttacatgaagacctgaat
gaatgtgggaatgaaccaccaatcgcagaactcacacctgaagaggaaaagcttagggaa
gctttacctatcaggattgcttcgaccattgaatgggaaaggtatttaaaaaacaatttt
agcatagtagaagatgtgtttcaagggcagtacttctccagattggaatgtacagtctgt
aaaagcacttcaactacttataactcattcagttcactgtccttgccaatcccattagat
cgacaaaatgtcacactagatgactgtttccaggctttttgttctgtagaagaattgaac
ggagatgacagatggcattgtccaagctgtaaaaaaaagcaggtcgcttttaagaaactt
ggtatctctagactaccaagtgttctgatcgttcactttaaaaggtttcaggtcaagtgg
gaaacaggtcatataatcaagatagacaagtttatcagttatccgttcaagctatcaatg
gacaaatattggcccaaagctcaatcagaagaagaactaagaaacttggagaagctacca
tcgagaaatcagaatccccctttcaattatcgattgacaggggtggctaatcattttggg
accagaacatcatctggtcactacacatcatatgttcaaaaaggtggccaatggtattac
tttgacgatagtgctgtgactagcaatgttgatcgtcataaaatcgtaaatgggaacgcc
tatgttttattttatcgacgtagttag

DBGET integrated database retrieval system