KEGG   Pichia pastoris: PAS_chr1-4_0047Help
Entry
PAS_chr1-4_0047   CDS       T01092                                 

Definition
Beta subunit of heterooctameric phosphofructokinase involved in glycolysis
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppa  Pichia pastoris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ppa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ppa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:join(1496126..1498556,1498627..1498952)
Genome map
AA seq 918 aa AA seqDB search
MPDASLFNGTSFITLFAPNISLFQASIDFYTDRLGFAIKETSNQKLVWLQLEEDSNNVSI
QLLLDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHPVQ
QSPNEISPFEVYTLDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRTEDDSEKLFTPI
RKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDV
RGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWP
SLIEELLQTERISQQQFETYQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICRAIDYID
ATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCDIVSKHRA
RGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTAVAFDRIY
ATLQGVEAVNAVLECNADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKRAIS
LRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKVAIINVGAPAGGMNSAVYSMATYCMSR
GHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDADIGMIAYFFEK
YGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLN
SFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISYVPEEGISLAQLEM
DINSLKESFANDQGKTKFRQTDFEVGECIEAIPGHVQQGGIPSPMDRVRASRFAIRAVSF
IEKHSDKCQAFKNSISFRQTDEITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNI
FWSNVREISDMLSGRTSL
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgcttcactctttaacggaacttcgtttataacgttatttgcgcccaacatc
tccttattccaggcctccattgatttctacacagatcgcttggggtttgctattaaggag
acctcaaatcagaagttagtttggttacagcttgaagaagattcaaataatgtttcaatt
caattgcttctagatccagaacatgctgcttccgtgtctcagattgatcagaatattcgc
aatttgaccagatcgttataccggaaagactggagatcaattcagtctaatattgcgttc
aagagctcttcactaagtaagctcgtcaagttgctgaaggatggaggccatcctgtacag
caaagtcctaatgagatttcaccttttgaagtttacacgttagatcccctaggctcattg
ataggtttcagcggattcaagaatccatttgctgtcaacgaacgttctttgcttccaaag
gtttccgaagagaaagcttaccgtactgaagatgactcagaaaagcttttcactcccatc
cgtaaaaccatcggagttatgacatccggaggtgactctccagggatgaaccctttcgtt
agagcggtggttcgggcaggaatctacaagggttgcaaagtattttgtattcacgaagga
tatgagggacttgtacgtgggggtgaaaaatacatcaaggagacgcaatggcacgacgtt
cgtggatggcttgtagaaggcggaaccaatataggaactgctaggtgcaaagaattcaga
gaacgctctggccgacttaaagcttgcaagaatatgattgatatgggtattgatgcgcta
atcgtttgtgggggtgatggttcgctaacaggtgcggaccgatttcgttcagaatggcca
agtttgattgaagagttattgcaaactgaacgaatctcccagcaacagtttgaaacttat
caaaatttgaatatatgcggagccgtcggctctatcgacaatgatatgtcatcaacagat
gccacgatcggagccttctcctctttggatagaatctgccgggctattgactacattgat
gctaccgccaattctcattctcgagccttcatcgttgaagtcatgggccgccattgtggt
tggttaggtcttttggctggtctagcgacaagtgcagactacatcttgatcccagagaaa
cctgcatcttcaagagagtggcaagatcaaatgtgtgacatagtcagcaaacatagggca
aggggaaaacgaaagaccattgttattgttgctgaaggtgctatcagcaatgatttgagt
ccaatttcctgcgatcaagtcaaggacgttctggtcaatagattagggcttgataccaga
gttaccactcttggtcacgtacaaaggggcggtactgcggttgcttttgacagaatatac
gctactttgcaaggggtcgaagccgttaatgctgttttggaatgcaatgcggacacgccg
tcacccatgattgctattaaggaagatcaaattacgagagttcctcttgttgacgctgtg
gagcttacacagcaagttgcaaagtccatcgaatctcgtaactttaagagggctatttca
ttgcgagattctgagtttgtcgaacacatgaagaactttatctcaactaactccgcggat
catgttcctccttctttacctctagaaaagcgaaagaaagttgcaatcataaacgttgga
gctccagcgggaggaatgaacagtgcggtttacagtatggccacctattgcatgtccaga
gggcatgttccatatgctatccacaacgggttcagtggtttggctcgtcatgaatctgtt
agatctataaactggttggacattgaaggttggggttctctaggtggctcagagatagga
accaacagaactcttccaaatgatgccgatattgggatgattgcctacttctttgaaaag
tatggttttgatggcctgattcttgttggtggatttgaagcttttatctcacttcatcaa
ttggaaagggcccgaatcaattatccgtctctaagaatacccttggttcttattcctgct
accatttctaacaatgtgcctggaaccgaatattccttgggttcagatacgtgtcttaac
tcttttatggaatactgtgatgtaatcaagcaatctgcagctgcaactagaaacagagtg
tttgttgttgaggtccagggtggaaattcaggatacattgcaacccatgcgcaactcgct
tgtggtgctcagatttcttacgtccctgaggaaggtatttcgctggctcagcttgaaatg
gatatcaattctttgaaagagtcctttgccaatgaccaaggaaagacaaaattcaggcag
actgattttgaagtcggagaatgcatcgaagctattccggggcatgttcagcagggtggt
attccttctccgatggatcgtgtgagggcctctagatttgcaattcgtgctgtctctttt
attgagaagcactctgataaatgtcaagctttcaaaaattcgattagtttccgacaaaca
gatgagatcacttccacggctgttgtccttggtattcacaagtcccaactgagattcact
ccaattcgacaattatacgattttgagtctgatgtaccaaggcgtatgagaaaaaatatt
ttttggagtaacgtacgagaaatcagtgatatgttaagtggaagaacctcgttatag

DBGET integrated database retrieval system