KEGG   Komagataella pastoris: PAS_chr1-4_0047Help
Entry
PAS_chr1-4_0047   CDS       T01092                                 

Definition
Beta subunit of heterooctameric phosphofructokinase involved in glycolysis
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppa  Komagataella pastoris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr1-4_0047
   01230 Biosynthesis of amino acids
    PAS_chr1-4_0047
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr1-4_0047
   00030 Pentose phosphate pathway
    PAS_chr1-4_0047
   00051 Fructose and mannose metabolism
    PAS_chr1-4_0047
   00052 Galactose metabolism
    PAS_chr1-4_0047
  Energy metabolism
   00680 Methane metabolism
    PAS_chr1-4_0047
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAS_chr1-4_0047
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAS_chr1-4_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1:join(1496126..1498556,1498627..1498952)
Genome map
AA seq 918 aa AA seqDB search
MPDASLFNGTSFITLFAPNISLFQASIDFYTDRLGFAIKETSNQKLVWLQLEEDSNNVSI
QLLLDPEHAASVSQIDQNIRNLTRSLYRKDWRSIQSNIAFKSSSLSKLVKLLKDGGHPVQ
QSPNEISPFEVYTLDPLGSLIGFSGFKNPFAVNERSLLPKVSEEKAYRTEDDSEKLFTPI
RKTIGVMTSGGDSPGMNPFVRAVVRAGIYKGCKVFCIHEGYEGLVRGGEKYIKETQWHDV
RGWLVEGGTNIGTARCKEFRERSGRLKACKNMIDMGIDALIVCGGDGSLTGADRFRSEWP
SLIEELLQTERISQQQFETYQNLNICGAVGSIDNDMSSTDATIGAFSSLDRICRAIDYID
ATANSHSRAFIVEVMGRHCGWLGLLAGLATSADYILIPEKPASSREWQDQMCDIVSKHRA
RGKRKTIVIVAEGAISNDLSPISCDQVKDVLVNRLGLDTRVTTLGHVQRGGTAVAFDRIY
ATLQGVEAVNAVLECNADTPSPMIAIKEDQITRVPLVDAVELTQQVAKSIESRNFKRAIS
LRDSEFVEHMKNFISTNSADHVPPSLPLEKRKKVAIINVGAPAGGMNSAVYSMATYCMSR
GHVPYAIHNGFSGLARHESVRSINWLDIEGWGSLGGSEIGTNRTLPNDADIGMIAYFFEK
YGFDGLILVGGFEAFISLHQLERARINYPSLRIPLVLIPATISNNVPGTEYSLGSDTCLN
SFMEYCDVIKQSAAATRNRVFVVEVQGGNSGYIATHAQLACGAQISYVPEEGISLAQLEM
DINSLKESFANDQGKTKFRQTDFEVGECIEAIPGHVQQGGIPSPMDRVRASRFAIRAVSF
IEKHSDKCQAFKNSISFRQTDEITSTAVVLGIHKSQLRFTPIRQLYDFESDVPRRMRKNI
FWSNVREISDMLSGRTSL
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgcttcactctttaacggaacttcgtttataacgttatttgcgcccaacatc
tccttattccaggcctccattgatttctacacagatcgcttggggtttgctattaaggag
acctcaaatcagaagttagtttggttacagcttgaagaagattcaaataatgtttcaatt
caattgcttctagatccagaacatgctgcttccgtgtctcagattgatcagaatattcgc
aatttgaccagatcgttataccggaaagactggagatcaattcagtctaatattgcgttc
aagagctcttcactaagtaagctcgtcaagttgctgaaggatggaggccatcctgtacag
caaagtcctaatgagatttcaccttttgaagtttacacgttagatcccctaggctcattg
ataggtttcagcggattcaagaatccatttgctgtcaacgaacgttctttgcttccaaag
gtttccgaagagaaagcttaccgtactgaagatgactcagaaaagcttttcactcccatc
cgtaaaaccatcggagttatgacatccggaggtgactctccagggatgaaccctttcgtt
agagcggtggttcgggcaggaatctacaagggttgcaaagtattttgtattcacgaagga
tatgagggacttgtacgtgggggtgaaaaatacatcaaggagacgcaatggcacgacgtt
cgtggatggcttgtagaaggcggaaccaatataggaactgctaggtgcaaagaattcaga
gaacgctctggccgacttaaagcttgcaagaatatgattgatatgggtattgatgcgcta
atcgtttgtgggggtgatggttcgctaacaggtgcggaccgatttcgttcagaatggcca
agtttgattgaagagttattgcaaactgaacgaatctcccagcaacagtttgaaacttat
caaaatttgaatatatgcggagccgtcggctctatcgacaatgatatgtcatcaacagat
gccacgatcggagccttctcctctttggatagaatctgccgggctattgactacattgat
gctaccgccaattctcattctcgagccttcatcgttgaagtcatgggccgccattgtggt
tggttaggtcttttggctggtctagcgacaagtgcagactacatcttgatcccagagaaa
cctgcatcttcaagagagtggcaagatcaaatgtgtgacatagtcagcaaacatagggca
aggggaaaacgaaagaccattgttattgttgctgaaggtgctatcagcaatgatttgagt
ccaatttcctgcgatcaagtcaaggacgttctggtcaatagattagggcttgataccaga
gttaccactcttggtcacgtacaaaggggcggtactgcggttgcttttgacagaatatac
gctactttgcaaggggtcgaagccgttaatgctgttttggaatgcaatgcggacacgccg
tcacccatgattgctattaaggaagatcaaattacgagagttcctcttgttgacgctgtg
gagcttacacagcaagttgcaaagtccatcgaatctcgtaactttaagagggctatttca
ttgcgagattctgagtttgtcgaacacatgaagaactttatctcaactaactccgcggat
catgttcctccttctttacctctagaaaagcgaaagaaagttgcaatcataaacgttgga
gctccagcgggaggaatgaacagtgcggtttacagtatggccacctattgcatgtccaga
gggcatgttccatatgctatccacaacgggttcagtggtttggctcgtcatgaatctgtt
agatctataaactggttggacattgaaggttggggttctctaggtggctcagagatagga
accaacagaactcttccaaatgatgccgatattgggatgattgcctacttctttgaaaag
tatggttttgatggcctgattcttgttggtggatttgaagcttttatctcacttcatcaa
ttggaaagggcccgaatcaattatccgtctctaagaatacccttggttcttattcctgct
accatttctaacaatgtgcctggaaccgaatattccttgggttcagatacgtgtcttaac
tcttttatggaatactgtgatgtaatcaagcaatctgcagctgcaactagaaacagagtg
tttgttgttgaggtccagggtggaaattcaggatacattgcaacccatgcgcaactcgct
tgtggtgctcagatttcttacgtccctgaggaaggtatttcgctggctcagcttgaaatg
gatatcaattctttgaaagagtcctttgccaatgaccaaggaaagacaaaattcaggcag
actgattttgaagtcggagaatgcatcgaagctattccggggcatgttcagcagggtggt
attccttctccgatggatcgtgtgagggcctctagatttgcaattcgtgctgtctctttt
attgagaagcactctgataaatgtcaagctttcaaaaattcgattagtttccgacaaaca
gatgagatcacttccacggctgttgtccttggtattcacaagtcccaactgagattcact
ccaattcgacaattatacgattttgagtctgatgtaccaaggcgtatgagaaaaaatatt
ttttggagtaacgtacgagaaatcagtgatatgttaagtggaagaacctcgttatag

DBGET integrated database retrieval system