KEGG   Komagataella phaffii: PAS_chr1-4_0271Help
Entry
PAS_chr1-4_0271   CDS       T01092                                 

Definition
(RefSeq) Mitogen-activated kinase kinase involved in protein kinase C signaling pathway
  KO
K08294  mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ppa  Komagataella phaffii
Pathway
ppa04011  MAPK signaling pathway - yeast
ppa04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAS_chr1-4_0271
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    PAS_chr1-4_0271
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PAS_chr1-4_0271
Protein kinases [BR:ppa01001]
 Serine/threonine kinases: STE group
  STE7 family
   PAS_chr1-4_0271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo Haspin_kinase Seadorna_VP7 HHH_4 APH
Motif
Other DBs
NCBI-GeneID: 8196942
NCBI-ProteinID: XP_002490386
UniProt: C4QXY2
Position
1:1896033..1897340
Genome map
AA seq 435 aa AA seqDB search
MIHKMSRSSDANPPEVMIGSPKSRRPMFIPEISSKRASSPSNRPKLPGLSIPAAISSSTS
TSITSNPEPRTNQKPAILGIPSTRTRGKSPVALNALNTEVSESPALLEELQSLSLAEGKP
GNSKVNVYDKEIDDLEEDDWKYLFNNDDIAELDVLGEGIGGSVRKCKLKHNSRLFALKII
TTDPNPDFQRQMIRELKFNRSFNSPNIVQYYGTFINEKSASIYICMEYMGGKSLDAIYKN
IKTRGGRIGEKVLGKIAESVLKGLSYLHERKIIHRDIKPQNILLSFNGEVKLCDFGVSGE
VINSLATTFTGTSYYMAPERIKNEPYTVTSDVWSLGLTLLEVAQGRFPYYSERDHIPLTP
IELLSMILNFTPTLEDEPGENIFWSPAFKSFLHYCLVKDRKKRHSPHQMLKHPWMISQSK
KSVKMDKFVRQCWEE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattcataaaatgtcaagatccagtgacgctaaccctccagaggttatgataggatca
ccaaagagcagaaggcccatgtttatacctgaaatttcttcaaagagggctagttcacct
tcgaatcgaccaaagttgcccggcttgtcaattcctgccgcaatatcgagctctacatca
acgtctataacgtcgaatcctgaaccaagaacaaaccagaagccagcaatattaggcata
ccatccaccaggacgcgaggcaagagcccagttgctttaaatgctctcaatacggaggtc
tctgaatcaccagcgctattagaagaacttcagagtctgagtctagcggagggtaaaccg
gggaattcaaaagtaaacgtatacgacaaagaaatagacgacttggaggaagatgattgg
aaatatctgttcaataacgacgatattgcagagcttgatgttcttggtgaaggtattgga
ggcagcgtcagaaagtgtaaattaaagcacaacagtagattgtttgctctaaaaattata
acaacagacccaaaccccgattttcaaagacaaatgatcagagaactaaaatttaatcga
agctttaattcgcctaatatcgtgcagtactatggaacctttatcaatgaaaaatcagct
tcgatctacatctgcatggaatatatgggaggtaaatcattggatgccatttacaaaaat
atcaaaacaaggggaggaaggataggagaaaaggtattgggaaaaatagcggaaagcgtg
ctaaaaggattgtcctaccttcatgaaagaaagattatacatcgggatatcaaaccccag
aatattttacttagtttcaatggagaagtcaaattatgcgattttggtgtcagcggagag
gtaattaatagtttagcaacaacattcacaggaacgtcttattatatggcgccagaaagg
atcaagaatgaaccatatacagtgactagtgatgtttggtctttagggttgacgttatta
gaggtagcccaaggaagattcccatattattcggaaagagatcacattccattgacgccg
atagagttactgtcaatgatattgaacttcacaccgaccctggaggatgagccaggggaa
aatatattctggtctcccgcattcaagtcatttttgcattattgtttggtcaaagaccga
aagaaacgtcattctcctcatcaaatgttgaaacatccatggatgataagccaatcaaag
aagagtgtcaaaatggacaagtttgtcagacagtgctgggaagagtag

DBGET integrated database retrieval system