KEGG   Pichia pastoris: PAS_chr1-4_0338Help
Entry
PAS_chr1-4_0338   CDS       T01092                                 

Definition
Isocitrate lyase, catalyzes the formation of succinate and glyoxylate from isocitrate
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppa  Pichia pastoris
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr1-4_0338
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAS_chr1-4_0338
Enzymes [BR:ppa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PAS_chr1-4_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2031599..2033248
Genome map
AA seq 549 aa AA seqDB search
MSGPYTKIDLDKEEQDFQNQIKEIEEWWSQPRWAKTKRIYNAEDIAKRRSSLSSVPASNQ
QAQKLFKLLGEHAKNETASFTFGALDPIHITQMAKYLDTIYVSGWQCSSTASTSNEPSPD
LADYPMDTVPNKVEHLFFAQLFHDRKQREERLSVSKQERAKLPYTDFLRPIIADADTGHG
GITAIIKLTKMFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPVQEHINRLVAIRTSADLF
QSDLIAVARTDSEAATLLTSTIDKRDHYFVIGATNPDIPDLIDVLTEAELQGKYGAELSQ
LEADWSKKAGLKLYHEAVFEAIDKSSSVKDKQAAKDKFSAKVGPLTGTSHKEAAKLAKEI
LGEEVFFDWEAPKVREGYYRYQGGTECAIMRARAYSPYADLVWMESKVPDYQQAVDFAKG
VKDLYPDQWLAYNLSPSFNWNKAMSPDEQETYIKRLGKLGYNWQFITLAGLHTTALAVDN
FSRDYQKIGMKAYGQQVQAKEIEDGVEIVKHQKWSGAEYIDGLLKLTTGGLSSTAAMGAG
VTEDQFKDH
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaccttacactaagattgacttagacaaggaagagcaagacttccaaaaccaa
atcaaggagattgaggaatggtggtctcagccacgttgggccaagaccaagcgtatttac
aacgctgaggacattgcaaagagaagatcctctttgtcttctgttccagccagtaaccag
caagcgcagaagcttttcaagctgttaggggaacacgccaagaacgagaccgcttctttc
accttcggagctttggatcctatccacatcactcagatggctaagtatttggacacgatt
tacgtttccggatggcaatgttcttctactgcatccacttctaacgaaccttccccagat
ttggctgactaccctatggacaccgttccaaacaaagttgagcacttattcttcgctcaa
ttgtttcacgacagaaagcaaagagaagagagattgtctgtttccaagcaggaaagagct
aagttgccttacactgacttcttgagaccaatcattgccgatgccgacactggacatgga
ggtatcaccgccattatcaagttgaccaagatgttcatcgagagaggtgcagctggtatt
catattgaggaccaagctccaggtaccaagaagtgtggacacatggccggtaaggtctta
gtccccgttcaagagcacatcaacagattagtcgctatcagaacctctgctgatttgttc
caaagtgacttgatcgctgtcgccagaactgactctgaagctgctactcttttgacctcc
actatcgataagagggatcattacttcgtcattggtgctaccaacccagacattcctgac
ttgatcgatgttttgaccgaggctgaattgcaaggtaagtacggtgccgagctctctcaa
ttggaggctgactggagtaagaaagctggcctgaaattataccacgaggctgtctttgaa
gcaattgacaagtcatcctccgtcaaggataagcaagccgcaaaggacaagttttctgcc
aaggttggcccattgaccggaacatcccacaaggaagctgctaagttggccaaggaaatt
cttggtgaggaagttttctttgactgggaggctccaaaggtcagagagggttactaccgt
taccaaggtggtaccgagtgtgccatcatgagagccagagcttacagtccatatgctgac
ttggtttggatggagtctaaggttccagactaccagcaagctgttgacttcgccaagggt
gtcaaggacctttacccagaccaatggttggcctacaacttgtctccatcattcaactgg
aacaaggccatgtctcctgacgaacaagagacttatatcaagagattgggtaaattggga
tacaactggcagttcattactcttgctggtctacacaccactgctttggctgttgacaac
ttctctagagattaccagaagattggtatgaaggcttacggacaacaagtccaggctaag
gaaattgaggacggtgtcgaaattgtcaagcaccagaaatggtcaggagccgagtacatt
gatggtctgttgaaattaaccactggtggtttgagttctacagctgccatgggtgccggt
gtgactgaagatcaattcaaggaccattaa

DBGET integrated database retrieval system