KEGG   Komagataella phaffii: PAS_chr1-4_0341Help
Entry
PAS_chr1-4_0341   CDS       T01092                                 

Definition
(RefSeq) Ubiquitin-specific protease
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
ppa  Komagataella phaffii
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAS_chr1-4_0341
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr1-4_0341
Transcription machinery [BR:ppa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PAS_chr1-4_0341
Ubiquitin system [BR:ppa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PAS_chr1-4_0341
Chromosome [BR:ppa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     PAS_chr1-4_0341
    SLIK complex
     PAS_chr1-4_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(2037157..2037613,2037673..2038724)
Genome map
AA seq 502 aa AA seqDB search
MTSTVKKTLEEAKFSPPVFDSCPHLKQILTSNAKDTVYRNYGLAVNVALALKLRNGNIPL
YKTSDGSKVEYKKLARLRNKAVRCRECLESLSCTYFCLQCSHVGCWKNGHASAHTKSTGH
VFGIDSQTGYIFCFRCGDYVGDQRLEFIRQSKQGERTEPIMNNLGTETIIDGSRPPSLKA
STGLRGFINMGATCFMSSIVQTIVHNPFVRDYFLSGYHAKCTKKMDTCITCCIDEIFKVF
YGTDETKGYGPTALLTAAWRVKNSLAGYSEQDAHEFWQFLLDEIHKSDTELHPELDDTST
CRCITHKTFAGQLQSTVTCEKCLHSKNTVDPMLDLSLEIAKISKDKVTLNDCLDLFTSKE
KLDSMTICSHCKKETTRTKQLLVRKLPPILAFQLKRFEHSASSSTKIETHVGFPLFLDME
PYTVSETLNSNEQGRASWGLMTYQLFAIVIHIGSVNTGHYICIIKNRDGNWFKFDDSRIT
LVSQDYVSKSNAYLLYYILCQA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacatctactgttaagaaaacgcttgaagaagccaaattttctcctccagtttttgat
tcgtgtcctcatttgaagcagattttgacctccaatgcaaaggacaccgtataccgtaac
tatgggcttgctgtcaacgttgccctcgcattgaagctccgaaatggaaatattccccta
tataagacgtcagacggatccaaagttgaatataaaaagctggcaaggttgagaaacaaa
gcggtgcgatgtcgtgagtgcttggaaagcttatcatgtacatatttctgcttgcagtgc
tcacatgttggatgttggaaaaacggccatgcatcggcccacactaagagtacggggcat
gtttttggcattgactcgcaaactggttacattttctgttttcgatgtggtgattatgtt
ggagatcaaaggttggagtttattagacaaagtaaacaaggtgaaaggactgaaccaata
atgaacaatttgggtacagaaacgataattgatggttccagaccgccttccttgaaagca
tctacaggcttgagaggcttcattaatatgggcgcaacttgttttatgagctcaattgtg
caaactattgttcataatccctttgtccgtgattactttttgagtggatatcatgccaaa
tgtaccaaaaaaatggatacatgcatcacatgttgcattgacgaaattttcaaagtgttc
tatggaacagatgaaacgaaaggctatggtcctactgctctcttgacggctgcatggaga
gttaagaattcactggcaggttattctgagcaagacgcacatgagttttggcagtttttg
ctagacgaaattcataaatctgataccgaactacatcccgaacttgatgatacttcaact
tgtcgttgtattacccataaaacttttgcaggccaactgcaaagcacagtgacatgcgaa
aaatgccttcatagcaaaaatactgtcgatccaatgttggacctatcacttgaaattgct
aagatttctaaagacaaagttaccttgaatgactgcttggatctgttcaccagtaaagag
aaattggattcgatgactatatgtagtcattgcaagaaagaaactacaaggacaaagcag
ctgctggtgagaaagctgcctcctattctggcattccagcttaaaaggtttgaacattca
gcatcttcatctaccaagattgaaactcatgtgggattcccattattcctagacatggaa
ccatacactgtttcagagactctcaactcgaatgagcaaggaagggcatcttggggtctt
atgacatatcagctttttgcaatagtaatacatattggaagcgtcaacacaggtcattac
atttgcattatcaagaatcgagatggaaattggttcaagtttgacgactcaagaattact
cttgtgagtcaagactacgtttcaaaaagtaacgcctatttgctgtactacatcttatgc
caagcataa

DBGET integrated database retrieval system