KEGG   Pichia pastoris: PAS_chr1-4_0390Help
Entry
PAS_chr1-4_0390   CDS       T01092                                 

Definition
Choline kinase, catalyzing the first step in phosphatidylcholine synthesis via the CDP-choline
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ppa  Pichia pastoris
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PAS_chr1-4_0390
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     PAS_chr1-4_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2128029..2129747
Genome map
AA seq 572 aa AA seqDB search
MEKHLKQKGSSASTRTRTRSRSGSRTREFHSIRRPSMHRTTSSGSIKSLTSDLGNDSLDG
SFNGEQDIEVPFVKAVLDHTLPTEYLKQDVIALLQSLRISKWHRLVPTENVIKELKLTRI
SGALTNSIYKVTYKHYYPLLLRIYGPNVESLIDRDTELKILFKLAKNNIGAKLLGCFTNG
RFEEFLNHSVTLVKEQLREPKISRMIARRMKELHTGVQLDKYEVTRGPTCWYMIEKWLGI
VENLLEGVDVQVQKSIFMVDIKTFRTHYEKYKKWVDGIYNGGLSYPPELVFCHNDTQYGN
LLFYNPLESELSELTISDTTASSPVETPKLYDSGRNISTQSIHSLTKDSTKMDKKLVVID
FEYAAANVPAYDISNHFCEWMTDYHNTTAPHLLEVKRYPTRDEKLNLIATYVNYNGIEKN
KRKNSFVEVSQENIKEVESKIKKLYNQCIYWRAASSVFWALWGVVQSGEDFKKYKSRQST
PTELDKSITKTTGIGPNGELYEITIDNEHDVGDGTVIEEAPESNDDFDYLQYTYQKVAMA
YGDWIQLGLVDQSALDAEHQKNVKFLSCELLE
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacacttgaaacagaagggttccagtgctagcacgagaacacggacaaggtct
cgatctggctctaggaccagggagtttcactccatcagaaggccctcaatgcatcgaacc
acttcgtccggatctatcaagtctttgacgtctgatttaggcaatgattccttggatggg
tcattcaatggcgaacaagacatagaagtgccgtttgttaaggctgtcttggatcacact
ttacctactgagtaccttaaacaggatgtcattgctctcttacaaagtttgaggatctcc
aagtggcacagactagttcctactgaaaacgttataaaagaactgaaacttactagaatc
agcggagcgttgactaattcaatttacaaagtcacctataagcactactatcctttgtta
cttaggatttatggtcctaatgttgagtctttgatagatagagatacagagttgaagatt
ctcttcaagctagccaagaataatatcggtgccaaactgttaggttgttttacaaatggt
agatttgaggaatttttgaaccactccgttaccctggttaaagagcaactcagggagcct
aagatcagtcgaatgattgctagaagaatgaaagaactccacactggtgtccaattagac
aagtacgaagtgactaggggcccaacctgttggtatatgattgaaaaatggcttggaatt
gtggagaacctgctggaaggagtggacgttcaagttcaaaagagtatttttatggttgac
atcaaaacctttaggacacattatgaaaagtacaagaaatgggtggatggcatttacaat
ggaggactttcttaccctccagaactagtattttgtcacaatgatactcaatacggcaat
ttgttattctacaatccactagagtctgaattatccgaattgaccatctcggatactact
gcaagttctccagtggagacccccaaactgtacgattcaggaagaaatatttctactcag
tcaatccactctttaaccaaagactctaccaagatggataagaaactagttgttatcgat
ttcgaatacgcagcagccaacgttcctgcgtatgacatctccaaccatttttgtgaatgg
atgactgactatcacaatacaacggccccacatttattggaagtaaagaggtatcctacc
agagatgagaaattaaacttgattgctacttacgtcaattataatggaatagagaagaac
aagagaaaaaattcatttgttgaagtttcacaggagaacatcaaggaggttgaatcgaaa
attaaaaaattatacaatcaatgtatttactggagagcagctagctccgtattttgggct
ctttggggagtagttcaaagtggagaggatttcaagaaatacaaatcaaggcagtcaacc
cctaccgaattagataaaagcattaccaagactacaggaatcggccctaatggtgaatta
tatgaaattactattgataatgaacacgacgttggtgacgggacggttattgaggaagca
ccagaatctaatgatgactttgattatttgcagtatacttatcaaaaagttgccatggct
tatggtgattggattcaattaggacttgtcgaccagtcagctcttgacgcagaacatcaa
aaaaatgtgaagtttctttcatgtgagttattagaatag

DBGET integrated database retrieval system