KEGG   Pichia pastoris: PAS_chr1-4_0459Help
Entry
PAS_chr1-4_0459   CDS       T01092                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppa  Pichia pastoris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppa01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2253809..2255092
Genome map
AA seq 427 aa AA seqDB search
MSNVQSFVNSSSEHMEGVTFQPVPGGSNILTPECLTLLTDLHRNFNARRKLLLQDFMSLH
QERYRGVLPTFSEESLILRQDDWKNEKATDLENLLESSPANGSLEGNVVSMNNIVLPVWE
NSLKIQALLHQKIKEGRDMIIEPRGLNYNEKSLMIDGEPVSGALLDFAIFYFKSFPLVDK
VTFYISSLSSRNEASFWRDVFEFTQHYYKTEINTILCIDSLDSLFQIEEILQQLKLFVVG
LHHNRYKYMNSFISTTGEVLAQESQLTYNTPLLFYYISMLKNVSQRRQIKLFNDPLLNLK
TPNYISEDDLLNGEILGGSITESALRSTIQLCMEELNLWWNKVPLDLSRVEFLRALLNQW
INKKAYFNNGVQLSSGDTQKLVRQYSTGQYDVDNMMSPNLISLSLEDYVTLKTYGSTIPI
NIHQQKL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgttcagtcctttgtgaattcttctagtgagcatatggaaggagttacgttt
caaccagtccctggaggcagcaatattttaactcccgaatgtctgactctgttaactgat
cttcatagaaacttcaatgcaagacgaaagcttttgttgcaggatttcatgtcccttcat
caagaaagatatcgtggagttttgccaacattctcggaggaatcattgattcttcgacaa
gatgattggaaaaatgaaaaagcaaccgacttggaaaatctattagaatcttcaccggcg
aacggtagtttggagggaaacgttgtgagcatgaataacattgtcttaccggtttgggag
aactctctcaaaattcaagccttgcttcatcaaaagataaaagaaggacgggatatgatt
attgagccaagaggactgaattataatgaaaaatctttgatgattgacggagagcctgtg
agcggagcacttctggattttgcaattttctacttcaaaagtttcccactcgttgataaa
gtaacgttctatatttcatctttatccagccgcaatgaagcaagcttctggagagatgtc
tttgaattcactcagcactattacaaaaccgaaatcaacactattctatgtatagacagc
ctggattctctgtttcaaatcgaagagattctccaacaattgaaactatttgtggtcggt
cttcatcacaacagatacaaatatatgaacagtttcatttccacaacaggtgaagtgtta
gcccaagagtctcaattaacatataacactccattattattctactacatttccatgttg
aaaaacgtcagtcagcgtcgtcaaataaaacttttcaatgatccgttgctaaatctcaaa
actccaaattacatcagtgaggatgatctgttgaacggtgaaattctgggcggtagtata
acggagagtgcactaaggtcaaccattcaactatgcatggaagaactaaatttatggtgg
aacaaagttccactagatctctccagagttgaattcttaagagctctgctgaatcagtgg
attaacaaaaaggcatacttcaataacggggttcaattatcctcgggggatacacaaaaa
ctcgttcgccaatacagtactggacaatatgatgttgacaacatgatgagccccaacctt
atatccttatctttggaagactatgttactcttaaaacttatgggagtaccattccgata
aatatccaccagcagaaattgtag

DBGET integrated database retrieval system