KEGG   Komagataella pastoris: PAS_chr1-4_0546Help
Entry
PAS_chr1-4_0546   CDS       T01092                                 

Definition
Clathrin heavy chain, subunit of the major coat protein
Orthology
K04646  
clathrin heavy chain
Organism
ppa  Komagataella pastoris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAS_chr1-4_0546
Exosome [BR:ppa04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAS_chr1-4_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2412412..2417382)
Genome map
AA seq 1656 aa AA seqDB search
MSSDIPIEFTEPLQLTDIGIQPQFLDFRSTTLESDRFVCVREQGANGNTVSIIDLHNNNN
VTKKNMTADNAIMHPSQNVISLRANGTTLQIFNLDTKQRLKSFTMSEPVIFWKWLNEQTL
GLVTQNAIFEWNVFDGTGDGPVRLADKHVSLTNNQIINYVSNKDNTWIAVTGIAQEEGRI
VGHIQLYSKARNISQAIDGHVCNFATLKLSGASVDTQVFVCGNRTATGGQLHVIEIDHQE
GAPVFQKKNVDIFFPADAANDFPVSVHVSQKYGIIYLLTKYGFIHLYDVESSTSLFVNRI
SAEPVFTAASYNNGTGIIAINRSGQVLTVDLSRESFIPYILNKLSNIPLALSLASRSGLP
GAENLFTQQFNQCLASGDYDNAAKIAASSEQLRTSETINRLKNLQPAPGQISPILSYFSI
LLDKGTLNKFESIELAKPVLQQDKKPLFEKWLKEDKLQSSEELGDIVKPFDTTLALAVYM
RAQVPVKVVSCLAEIGQFDKILPYCEKVNYHPEYTILIQNIVRVNPDKAAEFATSLLRQT
PGLDIEKIADIFLSQNYIQQGTAFLLDALKDDKPAEGHLQTRLLEINLLHAPQVADAILG
NNMFSQYDRPTIAALAEKAGLFQRALEHFDDIKDIKRVIVNTQAFPTDWLVNYFGKLNVE
QSVACLREMLSKNIAQNLQVVIQVATKYSDLIGPVTLIKVFEEFKCTEGEYYYLASIVNV
TQEPEVVFKYIEAAAKLGQVKEIERVTRENNVYNGEKVKNFLKEAKLDDQLPLIIVCDRY
DFVHDLVLYLYKNKFFKFIEVYVQQVNPSKTPQVIAGLLDVDCDEAIIQSLLQTVIGQVP
IAPLVEEVEKRNRLKLLLPFLEQTLQGGSADKTVYDTLAKIYIDSNNNPEKFLQDNDNYD
TLVVGKYCEKRDPYLAYIAYSKGQNDEELIKITNENAMFKYQARYLLSRSDRQLWSVVLS
EDNMYRRQLIDQVVGTAIPELEDPEPVSLAVEAFMDADLPSELIELLEKIILEPSPFNDN
PSLQELLILTAIKADQTRVDSYIEKLDDFDPEEIGSLATEAGLYEEAFKVYNKFELYGKA
LKVLVEDVMSLDRGEEYAEKLDKPELWSQLGAAQLNGLRIPEAIESYIKAGDPSNFEQVI
DIAEHAGKEEELIPFLKMARETLREPKVDGAIINAYANTDRLNDIEHFLQLSNAADLESI
GDKLYEKHNYEAAKLLYSSISNYSKLASTLVYLGDYQAAVDCARKASNVKVWKQVNEACI
DNKEFRLAQICGLNLIIHAEELDELVNKYEYFGYFDQLLSLFENGLGLERAHMGMFTELA
VLYTKYSPDKTMEHLKLFWSRINIPKVLRACEAAHLWPELIFLYCHYDEWDNAALTIIER
SSSAFEHSSFKEVIVKVSNLEIYYKAINFYLNEHPSLLTDLLSVMIPRIDLPRVVKLFQK
SDNLPLVKPFLISVLDKNNSIVNQAYHDLLIEEEDYKSLRSVIESNDKFDALGLAERLEK
HEVIFFRQIAAVLYRKNKKWNKAISILKTDRLWSDVIETAAISGSEKVASETLQYFVETG
NKECFVATLYACYHLVNPDSILELSWLHGLGDYTKPYEISIAKNNQDRINELYKDLKKRQ
SQETNADDEQAGSQRLLLTNGTGIGLQPTGTGFGGF
NT seq 4971 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgatattccaatcgagttcacagaaccccttcagttgaccgatatcggcatc
cagccccaattcctggattttcgatccacgacgttggaatctgatcgtttcgtgtgtgtc
agggaacaaggtgccaatggcaacactgtcagcatcattgacttgcacaacaacaacaat
gtgaccaaaaagaacatgacagcggataatgccatcatgcatccatctcagaacgttatt
tctctgcgtgctaacggaacaaccctacagatcttcaacctggataccaaacagagacta
aagtcgttcacgatgtcagaacccgttatattctggaaatggctcaatgagcagactctt
ggtttggtaactcagaacgcaatttttgagtggaatgtatttgatggcactggggatggt
ccagttagattggccgataaacatgtctctttaaccaacaaccagatcatcaactatgta
tcgaacaaggacaacacttggattgcagtcactggtatcgctcaagaagagggacgcatt
gtaggccacatccaattgtactcaaaggcaagaaatatctcccaggcaatcgacggtcac
gtctgtaatttcgccacattgaaattgagcggtgcctccgtcgacacacaggtatttgta
tgtggtaacagaacggccaccggtggtcaattacacgtaattgaaattgaccatcaagag
ggagctcctgttttccagaagaagaatgtggacattttctttcctgcagatgcagccaat
gatttcccagtatccgtccatgtttctcaaaaatacggtatcatctatctgcttacaaag
tacggtttcattcacttgtacgatgttgagtcaagcaccagtttgtttgtaaacagaata
tcggcagagcctgtatttactgccgcttcatacaacaatggtaccggtatcatcgccatc
aacagaagcggccaggtgctaactgttgacctctccagagaatcgttcattccttatatt
ttgaacaagctctctaacattcctttggctctatctcttgcttcaagaagtggacttcca
ggagctgagaatctttttactcaacaatttaatcagtgcttagcctcaggagactacgac
aatgctgccaagattgctgcctcttctgaacaactgagaacttctgagacgatcaaccgt
ctgaagaacttgcagccagccccaggtcagatctcccctatcttgagttacttttccatc
ctattggacaagggaaccttaaacaagttcgagtccatcgaattggctaagcccgttcta
caacaggataagaagcctctattcgagaaatggttaaaggaagacaagctgcaatcatcc
gaggagcttggtgacatcgtcaagccttttgataccacacttgccttggctgtctacatg
cgtgcacaagttccagttaaggtagtgtcatgccttgctgaaattggccaatttgacaag
atcttgccttactgtgaaaaggtcaactatcacccagaatacactatcttgattcaaaat
attgttagagtgaatccagacaaagcggctgagtttgccacatccttattgcgacaaact
ccaggtttagacattgagaaaattgctgatattttcttgtctcaaaactacattcagcaa
ggtaccgctttccttttggacgcattaaaagatgataaaccagcagagggccatttgcaa
acgcggttattggagattaatcttttgcatgctcctcaagtggctgatgctattctgggg
aacaacatgttttcgcaatatgaccgaccaactattgccgcattggcagaaaaggctggt
ttgtttcaaagagcattggagcactttgacgatatcaaggacattaagcgagtgattgtg
aacactcaagcttttccaaccgactggttagtcaactactttggcaaactcaacgttgaa
caatctgtagcatgtttaagagaaatgctctccaagaatattgcacagaacttgcaggtt
gtgattcaagtggccaccaaatattcagacttgataggaccagtaactttgatcaaggtg
tttgaggaatttaagtgcacagaaggtgaatactattatttggcctctattgttaacgta
acgcaagaaccagaagttgtcttcaagtacattgaagccgctgctaagttgggacaagtt
aaagaaatcgagagagtcaccagagagaataacgtctacaatggtgaaaaagttaagaac
ttcttgaaagaagctaagttggatgaccagttacctttgatcattgtttgtgatcgttat
gactttgttcatgatttggtattgtacctgtacaagaataaatttttcaagtttatcgaa
gtttatgttcagcaagtcaatccttccaaaacaccacaagtcattgcaggtcttttggat
gttgattgtgatgaggccattatacaatccctactacaaacagtaattggccaagttcca
attgccccattggtagaggaagtcgaaaagcgaaacagattgaagctgttgcttcctttc
ttagaacaaactcttcaaggagggtctgctgacaaaaccgtgtacgacactttggccaaa
atttacattgactctaacaacaatcctgaaaaattcttgcaggataacgataactacgat
acacttgttgttggtaaatattgtgaaaagagagatccataccttgcttacattgcttat
tctaagggtcaaaatgatgaagaactcatcaaaataacaaatgaaaatgcaatgttcaaa
taccaagcaagatacttattaagtagatctgaccgtcaattgtggtcagttgttctttct
gaagacaacatgtacaggagacaacttatcgaccaagttgttggtactgccattccagaa
cttgaagatcctgagccagtatcattggctgtcgaggcttttatggacgccgacttgcca
tctgaactgattgagctgttagaaaagattatcttggagccttcccctttcaacgataac
ccttccttacaggaactattgattttgaccgccatcaaggctgatcaaacaagagttgat
tcatacattgaaaagcttgatgactttgatccggaggagattggctctttggccacagaa
gctggattgtatgaagaggcattcaaggtgtacaacaaatttgaactgtacggtaaggct
ttgaaggtgctagtggaagatgtcatgtctcttgatagaggtgaagaatatgctgaaaag
cttgacaaacctgaactgtggtcgcaattgggtgctgcccagctaaatggtttacgaatt
ccagaggctatcgaatcttatatcaaggctggcgatccttccaactttgagcaagtcatt
gacattgcggagcatgcaggaaaagaggaggaacttattccattcctaaagatggctaga
gaaaccttaagagaaccaaaggttgacggcgctatcatcaatgcctatgctaacacagat
agattgaacgatattgaacactttttgcaattgtcaaatgctgctgatcttgaatctatt
ggtgacaagttgtacgaaaagcacaactatgaagctgcgaagctgctttattccagtatt
tctaactacagcaagctggcatctaccttagtttacctgggagattaccaagctgctgtc
gattgtgctagaaaggcatccaatgtgaaggtatggaagcaagtcaacgaagcttgtatc
gataacaaagaattccgtttggcccagatctgtggtttgaatttgatcattcatgccgag
gaacttgacgagcttgttaacaaatacgaatactttggatactttgaccaacttctttca
ttgtttgaaaacggtctagggttggaacgtgctcatatgggtatgtttactgagcttgct
gttttgtacacgaagtattctccagataaaaccatggagcatttgaaattgttttggtct
cgtatcaacattccaaaagttttgagagcttgtgaggctgctcatctatggcctgaactg
attttcttatactgtcactacgatgagtgggacaacgctgctttgactatcattgaaaga
tcaagtagtgcatttgaacacagctcattcaaggaggttattgtcaaggtgtcgaactta
gaaatctactacaaggctatcaacttttacctgaacgagcatccatcgttgttgacggac
ttgctatctgttatgattccaagaatcgacttaccaagagtagtaaagttgttccaaaaa
tcggacaacctcccattagtgaagccgttcttaatctccgtcttggacaaaaataactct
attgtgaatcaagcataccacgatttgcttattgaagaagaggattacaagtctttgaga
tcagtaattgaatccaacgataagtttgatgctctaggactggcagaaagattggagaaa
catgaggtaatctttttcagacaaattgcagcagtcctttaccgtaagaacaagaagtgg
aacaaagctatttccattttgaaaacagataggttgtggagcgacgtcattgaaactgca
gccatttctggtagtgagaaggttgcatctgaaacattgcagtacttcgttgagactggt
aataaggagtgctttgtagccactttgtatgcctgttatcatctagtcaaccccgactca
attttagaattgagctggcttcatggtttgggtgattacactaagccttatgaaatctcc
attgccaaaaataatcaggacagaatcaacgagttgtacaaggatctgaagaagaggcag
agccaagaaacaaatgctgatgatgaacaggcagggtctcaaagattgttgttaaccaat
ggtactggcattggtctgcaaccaaccggtactggatttgggggattttag

DBGET integrated database retrieval system