KEGG   Komagataella phaffii: PAS_chr1-4_0585Help
Entry
PAS_chr1-4_0585   CDS       T01092                                 

Definition
(RefSeq) Ubiquitin-specific protease that interacts with Bre5p
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
ppa  Komagataella phaffii
Pathway
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    PAS_chr1-4_0585
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAS_chr1-4_0585
Peptidases [BR:ppa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAS_chr1-4_0585
Ubiquitin system [BR:ppa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PAS_chr1-4_0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2496675..2498450
Genome map
AA seq 591 aa AA seqDB search
MTTGTQSSPQLTSDDLHKIDEYFRRHLKLQIAADNDSEHDQLPFFVGVTRQDFHHLKQLS
LRNRRLHSDPTYTLKVQRELSSIKKVEDKPAAYKTWASLLVKPSTNYHQNKLTKQDSPSN
HIKQSTSLPASSSQLSPQFQPLGAVLLRYMYDKDYQKPPDVKLLPHGLINRGNICYMNSV
LQLFIFCKPLFRVLRCIREKTIAHVSGTSDTPILDALTLLLERFQHKESHESASVDDFGE
PLSQESFYTSIISLPKFSHLRWGQQEDAEEFMGYVLDELHEEFISQMTKLTDTEKSQLLA
SVNNVESKKQISEALNLIQKKPGSSPKSKYDTEDKHDDDGWCEVGSNNKLSAKRTVEVKP
SPITEIFGGQFRSVLNVPRQKNGRSITLDPFLHVQLDISEPNVSSVEDAFTYLSQIEVIP
YKSSNGNLVQATKQNMIDKLPEVLIIHLKRFSYVRQESSSDVGTPVPQSSSPSPSPSPSG
STQNGFHSKNNDAEMGCIQKIQKIIKFGHALTIPEACLSRGETNNEYQLQGVIYHHGNST
EGGHYTIDVKNDRDSWLRIDDTNIVPLTPQQVVGASTNDGKDAYILVYQKK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggtacccagtcatcacctcaactgaccagtgatgatcttcacaaaattgat
gagtattttcgacgacatttgaaactccaaatagcggctgacaatgactcggaacatgat
caactgcctttttttgttggagtcacaagacaggatttccaccatcttaaacagctgtca
ctgaggaacagacggcttcactctgaccctacatatacattgaaagtacaaagagaacta
tcctccattaaaaaagtcgaagacaagcctgcagcatacaagacgtgggcttcgttgttg
gtaaaaccctccacgaattatcaccagaataaattaaccaaacaggactcaccctctaac
cacattaaacagtcaacctcattgccagcttcgtcatctcaattgtcccctcaattccaa
cctctaggtgctgtgctactaagatacatgtacgacaaggattaccaaaaacctcctgat
gtaaaacttcttcctcatggcctaataaacaggggtaacatctgctacatgaactcggtt
ctacaattgttcatcttttgcaagccactgttccgtgtgctccgttgcatacgagaaaag
acgatagctcatgtttctggtacgtctgacacacctattttggatgcattgactctgttg
ttggaacgatttcaacacaaagagtcacacgagtcagcatctgtggatgatttcggggaa
ccactatcacaagagtcattttacacatctataatatcactgcccaagttctctcattta
cgatgggggcaacaggaagatgctgaagagttcatgggttatgtattggacgaattgcac
gaagagttcatttcccagatgaccaaactcacagacactgaaaagagtcagcttcttgcc
agcgtgaataacgttgagagtaagaaacagatctctgaggcgttgaatctgatccaaaaa
aagccaggctcgtctccaaaaagcaaatatgataccgaggataagcacgacgatgacggg
tggtgcgaggttggatccaacaataaattatctgccaagcgtacagttgaagtgaaaccg
tccccgatcaccgagatattcggaggacaatttaggtcagtgctgaacgttcctagacag
aaaaacggcagatccataacgttagacccatttttgcatgttcagttggatatctctgaa
cccaatgtttcttctgtggaagatgcattcacatatctgtctcagatcgaggttataccc
tacaaatcaagcaacggcaatctggtccaagctacgaagcaaaatatgatcgataaatta
ccagaggtgctaattattcatctgaaaaggttttcctacgtgagacaggagagttcatcc
gacgtaggcactccagttccacagtcaagttcaccatctccatcaccttctccatctggc
tccacccagaacggatttcacagcaaaaacaacgatgctgagatgggatgtattcagaag
attcagaagataataaagtttggccatgcactgaccattccagaggcttgcttgtctcgt
ggcgagactaacaacgagtaccagctccagggtgtgatataccaccacgggaacagcaca
gagggaggacactacacgattgacgtcaagaacgaccgtgattcatggcttcgcatagac
gacacgaacatagtcccactcactccacagcaggtcgtaggcgcttctaccaacgacggg
aaggatgcgtatatactagtctaccaaaagaaatag

DBGET integrated database retrieval system