KEGG   Komagataella pastoris: PAS_chr1-4_0673Help
Entry
PAS_chr1-4_0673   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ppa  Komagataella pastoris
Brite
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PAS_chr1-4_0673
    1.3.1.94  polyprenol reductase
     PAS_chr1-4_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2063188..2063982
Genome map
AA seq 264 aa AA seqDB search
MSFSSKVVLVLADYYASLFSVALLIGIISVISAKFIPELNGLLKYGKTLDVGSVTKWKWL
YVPKSWFLHFYILDFTWALIGLLLVGVNSSRSSIILIFNFLQSLRRIYECAYVSKFAEYS
KIHLSHYLAGIVFYTIANLQVIVPHIFTNVPGDSETVVPQWSLFLASSLFIMGTIDQFFN
HCHLANLKKYTAPSFGLFRYVVCAHYFDEILIYLAEYVILQDSTSFLIILWVIVNLGASA
CETRKFYMEKRSIVGPFIMIPLVW
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctcatctaaggtcgtcttagtgctggctgattattacgccagcttattcagt
gtggcattactgattggcattatcagtgtaatttctgctaagtttatccctgaactgaac
ggcttgctgaaatatggtaagacgttggatgtcggttctgtaactaaatggaaatggtta
tacgtaccaaaaagttggttcttgcatttttacattctagattttacgtgggcacttatt
ggactgctccttgttggagtgaatagctccaggtcatcaattatacttatattcaatttt
ctccagtcactaagaagaatatacgagtgtgcatatgtaagcaagtttgcagagtattca
aagattcatttgtcacactatttggctggaattgtgttctatacaattgctaatctgcag
gttattgttccccatatttttaccaatgttcctggtgattctgaaactgttgttcctcag
tggagtctgttcctggcctcctccctattcataatgggtactatagaccagtttttcaac
cattgtcacttggcaaacttgaaaaagtacaccgctccaagcttcgggttattcagatac
gtcgtatgtgcccattacttcgatgagattttaatatatctagcggaatacgtgatttta
caggattccacgagttttcttattatactatgggtcattgttaacttgggagcatcagca
tgcgagactagaaaattctatatggaaaagaggtctatagtcggccctttcatcatgatt
ccactggtatggtaa

DBGET integrated database retrieval system