KEGG   Komagataella pastoris: PAS_chr1-4_0697Help
Entry
PAS_chr1-4_0697   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ppa  Komagataella pastoris
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAS_chr1-4_0697
   00670 One carbon pool by folate
    PAS_chr1-4_0697
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PAS_chr1-4_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1902920..1903534)
Genome map
AA seq 204 aa AA seqDB search
MSRPFKVNIIVAALIPGHGIGLKGKLPWSLKNEMKYFRLLTTNTISPTSKNVVIMGRNTW
ESIPSRFRPLQNRLNIVLTRNANISVENGAAVDDSVLVADSLKNGLDIIEKTGNIEEVFL
IGGADLYNQCLASGLVDRIFLTEVKSLNGQIETDVSIKIDPSQWIKQESQVLEKYLQDHG
VNGFQLDGNKEGELVYDFTLLERR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaccgttcaaagtgaacattattgtggcagcgttgatacctgggcatgggatt
ggcttaaaggggaaactaccttggtctctgaaaaatgaaatgaaatatttccgtcttctc
acaacaaacacaatctcaccaacttccaaaaatgtcgttatcatgggcagaaatacgtgg
gaatcaattccctccagattcaggccgttacaaaacagattgaatatcgtgcttaccagg
aatgccaatatttctgttgaaaatggtgctgcggttgacgactccgtgctggtggctgat
tccctgaagaatggattggacattatagaaaagacaggaaacatagaggaagtgttcttg
ataggaggagctgatctttataaccaatgccttgcatctggtcttgttgaccgtatattt
ttaacagaagtgaagtccttgaacggacaaattgagactgatgtgtccatcaagattgac
ccttcccaatggatcaagcaggagtcccaagtcctggagaaatacctccaagaccatgga
gtgaacggcttccagttagacgggaacaaagagggagagctagtctacgactttactttg
ctggagcgaagataa

DBGET integrated database retrieval system