KEGG   Pichia pastoris: PAS_chr2-1_0072Help
Entry
PAS_chr2-1_0072   CDS       T01092                                 

Definition
Delta(9) fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ppa  Pichia pastoris
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PAS_chr2-1_0072
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PAS_chr2-1_0072
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PAS_chr2-1_0072
Lipid biosynthesis proteins [BR:ppa01004]
 Desaturase
  First
   PAS_chr2-1_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:130900..132387
Genome map
AA seq 495 aa AA seqDB search
MEQPQAMEKVESVDVTEANAVAAGTNKLTKRIVAAGLGGKLMGTKSMVDVTADQLAKDSI
NELLARDKALKEKYEKQKHISEQPWTKDNWHQHINWLNMILVCGLPLFGAIATYYKPPTK
ETVILGVVLYILGGLSITAGYHRLWSHRAYSARTPLKVLFALFGAGAVEGSIKWWSHSHR
VHHRYTDTHRDPYDARKGFWYSHMGWMLTKPNPRYKARADISDLADDWIVRFQHRHYLLI
MTFMALILPTIIAKYFWDDAWGGFIYGGIFKVFVIQQATFCVNSLAHWIGVQPFDDRRTP
RDHFLTAIVTFGEGYHNFHHEFPSDYRNALKWYQYDPTKIVIYLSSKVGLSYNLKTFSDN
AIKQGLVQQQQKKLDSMRAHLNWGTPLQDLPVWDKSEFFEKSKDKKGLVIISGIVHNVEN
FIGEHPGGEKLVKGALGKDATTAFNGGVYAHSNAAHNLLATMRVAVIRDGNANANTFSLQ
NEFLDKKAAAAAASN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaccacaagcaatggaaaaggttgagtctgtcgacgttacagaggcaaacgca
gttgctgctggaaccaacaaactcaccaagagaattgtagctgctggtctgggaggtaag
ttgatgggtaccaagtcaatggtcgacgtcacagccgatcaactggctaaggactctatc
aacgagcttttggccagagacaaggctttgaaggagaagtacgagaagcagaaacatatc
agtgaacaaccatggactaaggacaattggcaccaacacataaattggttgaacatgatc
ttggtttgcggtttgcccctgtttggagctattgcaacgtattacaaaccacctaccaag
gagaccgttatactgggagttgttttgtacattctcggtggtctgtcaattacagctggt
taccacagactgtggtctcatagagcctattcggctagaactccgttaaaggttttattt
gccctctttggagccggagctgtggagggttccatcaaatggtggtctcactctcacaga
gttcatcacagatacacagacactcatagggacccatatgatgccagaaagggattctgg
tactcccacatgggttggatgttaaccaagccaaacccaagatacaaggcaagagccgat
atctcagacctcgctgatgactggattgtcagatttcaacacagacactacctgttaatt
atgactttcatggcccttattttgcccactattattgccaagtatttctgggacgacgca
tggggtggatttatctacggtggtatcttcaaagttttcgtcattcaacaagccactttc
tgtgttaactctcttgctcactggattggtgttcaaccgttcgatgacaggaggacacca
agagatcactttttgactgctatcgtcaccttcggtgagggataccacaacttccaccac
gagttcccatcagattacagaaacgctctgaagtggtaccaatacgatccaacaaagatt
gtcatttacttatcatctaaggttggattgtcttacaatttgaagactttttctgacaat
gccatcaaacagggtttggtgcaacaacagcagaagaagctggactccatgagggctcat
cttaactggggtactccattacaagacttgccagtctgggataagtctgagttcttcgag
aagtctaaagataagaaaggtttggtcattatttctggtattgttcataacgttgagaat
ttcattggtgaacatccaggtggagagaaacttgtcaagggtgccctgggcaaggatgct
actactgctttcaatggaggtgtttatgcgcactccaatgcggcccacaacttattagcc
actatgagagtggctgtcataagggatggtaacgccaatgcaaacactttctccttgcag
aacgagtttttggacaagaaagccgccgctgcagctgcttcaaattaa

DBGET integrated database retrieval system