KEGG   Pichia pastoris: PAS_chr2-1_0115Help
Entry
PAS_chr2-1_0115   CDS       T01092                                 

Definition
Mitochondrial cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppa  Pichia pastoris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(210225..211856)
Genome map
AA seq 543 aa AA seqDB search
MDLINSLIAPFRNFYQRLAIRLAPLGRVLLYPYVLFLAHLQSVHFVVYVQAKNLELYYRR
EAQRFTSGSRRSTTFKDKSQELDQWKLDFGTSRPIAEEVKPLFRASVNPRDVMLKAWGRT
DYYYDRYVVHTPFCIIVRLSGERNRYIYSPRPGTKLPFVLSELPEPDQYHFSPEATRSFN
LNKAEVPKPVEKPLVKLFEREVIPEVVAKPDTPAIDKSPIVLDADTGTKFSSSHTPLTGQ
LTVSKTGSPRNRRIKLVVNKKPKAPFIGSFYDYEHVRHEIINCFDRPELDYGSLAPNIVR
LAWHVSATYDQRTGTGGSNGCTIRFPPELTDPGNTGLHPAMSALNLIQAKFPWISYADLY
TFAGAIAIEYLGGPKIDWKPGRVDCTDQSLVPPNGRLPLGSLGADHIRDVFINALGFDDR
AAVCLIGGGHALGRTHAKYSGWDGKWTENPLQFSNQFFLELLTHEWDECTVPETGMKQFC
YEKKRLMMLNTDMALLRDPSFAKWVKIYGEDEKLFFDEFSQDFAKLLELGVDRDSDGIAR
KKF
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatctgattaactctttaatagcgccattcaggaacttctatcagagattggctatc
agattagcacctttgggaagagttctcctctatccatatgttcttttcctggctcatctc
caatcagtacactttgttgtttacgtgcaagcaaagaatctggagctctattaccgtaga
gaagctcagagattcacttctggtagcaggaggtcgacaacgttcaaagataaatcacag
gaattggaccagtggaagctggattttggtacttcaaggccaatcgcagaggaggtgaag
cctttattcagggcatctgtgaatccgagagacgtgatgctcaaagcttggggtagaact
gattattactatgacagatatgttgtccacacccctttttgtattattgttcgtctatct
ggggaaagaaaccggtacatatattctccacgaccaggaacaaaacttccttttgttctt
tctgaattacctgaacctgaccagtatcatttttctccagaagcgaccagaagcttcaat
ctcaataaggcggaagtcccaaagcctgtggaaaagccattggttaaactctttgaacga
gaagtcattccagaagtggtggcaaagccagacacgccggccatcgataaaagtccaata
gttttggatgcggatacagggaccaaattctcatctagccatactcctttgactggtcaa
ttgaccgtttcgaaaacgggctctccaagaaatagaagaattaagcttgtagttaataag
aaaccaaaggcacctttcattgggtcgttttatgattacgagcacgtcagacatgagatc
attaattgtttcgataggccagaacttgactacggatctctagcgcccaatatagtgagg
ttagcttggcatgtatctgccacatatgatcaaagaactggtactggaggcagtaacgga
tgtaccatcagattcccacctgaattgacagatccaggaaatactggactgcaccctgcc
atgtcagcgctaaacttaattcaggctaaatttccatggatatcctatgctgatctctac
acttttgctggagccattgcaattgagtatttgggaggtccgaaaatagactggaaacct
ggtagagtggattgtaccgaccaatctctggtacccccaaatggtagactgccgttggga
agcttgggtgcagatcatatcagagatgtgttcatcaatgcgcttggattcgacgatagg
gctgctgtttgtctaattggaggtggccatgcactaggaaggactcatgccaagtatagt
ggctgggatggaaaatggacagagaatcctcttcagttctcaaatcagttttttttggaa
ttgttaactcatgagtgggacgaatgtacagttcctgaaacaggaatgaaacagttctgc
tacgaaaagaaacgtttaatgatgctgaataccgatatggcactgctcagagacccatca
tttgctaagtgggtcaagatctatggggaggatgagaagttgttttttgatgaattcagt
caggattttgcaaagcttctagagctaggtgttgatagagatagcgatggaattgctagg
aaaaaattctaa

DBGET integrated database retrieval system