KEGG   Komagataella pastoris: PAS_chr2-1_0199Help
Entry
PAS_chr2-1_0199   CDS       T01092                                 

Definition
Essential protein required for maturation of Gas1p and Pho8p, proposed to be involved in protein tra
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ppa  Komagataella pastoris
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PAS_chr2-1_0199
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PAS_chr2-1_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:371168..372085
Genome map
AA seq 305 aa AA seqDB search
MVEDKTELLKTPLHGVYIPCALIVFGVAIHDYHFIPHTLLVLGLFVGIRLLIAYNKRASI
QSDKWNDFELIDKTVVSKNSAIYRFKLYRDEEILDIPVGHHLACQINVDGKNEVRYYTPI
SSQFDQGFFDILVKSYKDGSVSKAFASLNQGQTVKFKGPVGRMSYKNNMASEIGMIAGGS
GITPILQVLSYITTTPEDTTRINLLFANEYENDILLRDEIDELARIYPFFDVHYTLTHPP
ENWDGDVGYVTKEMIEKYLPPPTKTSKIFISGPLEMKKLCLELTEELGFDKGKLNSDQND
QVFCF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggataaaacagaattgctcaagacacccctacatggagtgtatatcccctgt
gcgctcatcgtgtttggggttgcaatccatgactaccacttcatcccccataccctactg
gttttggggttgtttgttggtattcgtctattaatagcctacaacaaacgtgcttcaata
caaagtgataaatggaatgattttgagctaatagataaaactgtcgtctccaaaaattct
gctatatatcgattcaagctgtacagagacgaggaaattttggacatacctgttggccac
catctagcctgtcaaatcaatgttgatggtaaaaatgaagtgagatactacacccccatt
tcctcccaatttgaccaagggttctttgatatcctggtgaaatcttacaaggatggttcc
gtttccaaagcctttgcctcgttgaatcaagggcaaactgtcaagtttaaaggccccgtt
ggaagaatgtcctacaagaataacatggcttcagagataggtatgattgctggggggtcg
ggtatcactcctattctccaagttttgagctacataactactactcctgaagataccact
agaatcaatttgttgttcgcaaatgagtacgagaacgacatattactacgtgacgaaatt
gacgaattggcccgcatatacccattctttgacgttcattacacccttactcatcctcct
gagaactgggatggtgatgtcggatatgtcaccaaagaaatgatcgaaaagtacctccct
ccccccacgaaaacctccaaaattttcatctctggtccattagaaatgaagaagctttgt
ctggaactgacagaggaacttggatttgataaaggaaagttgaactctgaccaaaatgac
caggtgttttgtttctaa

DBGET integrated database retrieval system