KEGG   Komagataella pastoris: PAS_chr2-1_0212Help
Entry
PAS_chr2-1_0212   CDS       T01092                                 

Definition
Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to prote
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ppa  Komagataella pastoris
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PAS_chr2-1_0212
Enzymes [BR:ppa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     PAS_chr2-1_0212
Glycosyltransferases [BR:ppa01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PAS_chr2-1_0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(393967..396336)
Genome map
AA seq 789 aa AA seqDB search
MCQIFLPQNVTRCSVSLLTMSKTSPQEVPENTTELKISKGELRPFIVTSPSPQLSKSRSV
TSTKEKLILASLFIFAMVIRFHNVAHPDSVVFDEVHFGGFARKYILGTFFMDVHPPLAKL
LFAGVGSLGGYDGEFEFKKIGDEFPENVPYVLMRYLPSGMGVGTCIMLYLTLRASGCQPI
VCALTTALLIIENANVTISRFILLDSPMLFFIASTVYSFKKFQIQEPFTFQWYKTLIATG
VSLGLAASSKWVGLFTVAWIGLITIWDLWFIIGDLTVSVKKIFGHFITRAVAFLVVPTLI
YLTFFAIHLQVLTKEGDGGAFMSSVFRSTLEGNAVPKQSLANVGLGSLVTIRHLNTRGGY
LHSHNHLYEGGSGQQQVTLYPHIDSNNQWIVQDYNATEEPTEFVPLKDGVKIRLNHKLTS
RRLHSHNLRPPVTEQDWQNEVSAYGHEGFGGDANDDFVVEIAKDLSTTEEAKENVRAIQT
VFRLRHAMTGCYLFSHEVKLPKWAYEQQEVTCATQGIKPLSYWYVETNENPFLDKEVDEI
VSYPVPTFFQKVAELHARMWKINKGLTDHHVYESSPDSWPFLLRGISYWSKNHSQIYFIG
NAVTWWTVTASIALFSVFLVFSILRWQRGFGFSVDPTVFNFNVQMLHYILGWVLHYLPSF
LMARQLFLHHYLPSLYFGILALGHVFEIIHSYVFKNKQVVSYSIFVLFFAVALSFFQRYS
PLIYAGRWTKDQCNESKILKWDFDCNTFPSHTSQYEIWASPVQTSTPKEGTHSESTVGEP
DVEKLGETV
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtgccagatatttctcccgcaaaacgtaacacgttgttctgtttcccttttgacaatg
agtaaaacaagtcctcaagaggtgccagaaaacactactgagcttaaaatctcaaaagga
gagctccgtccttttattgtgacctctccatctcctcaattgagcaagtctcgttctgtg
acttcaaccaaggagaagctgatattggctagtttgttcatatttgcaatggtcatcagg
ttccacaacgtcgcccaccctgacagcgttgtgtttgatgaagttcactttggggggttt
gccagaaagtacattttgggaacctttttcatggatgttcatccgccattggccaagcta
ttatttgctggtgttggcagtcttggtggatacgatggagagtttgagttcaagaaaatt
ggtgacgaattcccagagaatgttccttatgtgctcatgagatatcttccctctggtatg
ggagttggaacatgtattatgttgtatttgactctgagagcttctggttgtcaaccaata
gtctgtgctctgacaaccgctcttttgatcattgagaatgctaatgttacaatctccaga
ttcattttgctggattcgccaatgctgttttttattgcttcaacagtttactctttcaag
aaatttcaaattcaggaaccgtttaccttccaatggtacaagacccttattgctactggt
gtttctttagggttagcagcttccagtaaatgggttggtttgttcaccgttgcctggatt
ggattgataacaatttgggacttatggttcatcattggtgatttgactgtttctgtaaag
aaaattttcggccattttatcaccagagctgtagctttcttagtcgtccccactctgatc
tacctcactttctttgccatccatttgcaagtcttaaccaaggaaggtgatggtggtgct
ttcatgtcttccgtcttcagatcgaccttagaaggtaatgctgttccaaaacagtcgctg
gccaacgttggtttgggctctttagtcactatccgtcatttgaacaccagaggtggttac
ttacactctcacaatcatctttacgagggtggttctggtcaacagcaggtcaccttgtac
ccacacattgattctaataatcaatggattgtacaggattacaacgcgactgaggagcca
actgaatttgttccattgaaagacggtgtcaaaatcagattaaaccacaaattgacttcc
cgaagattgcactctcataacctcagacctcctgtgactgaacaagattggcaaaatgag
gtatctgcttatggacatgagggctttggcggtgatgccaatgatgactttgttgtggag
attgccaaggatctttcaactactgaagaagctaaggaaaacgttagggccattcaaact
gtttttagattgagacatgcgatgactggttgttacttgttctcccacgaagtcaagctt
cccaagtgggcatatgagcaacaagaggttacttgtgctactcaaggtatcaaaccacta
tcttactggtacgttgagaccaacgaaaacccattcttggataaagaggttgatgaaata
gttagctatcctgttccgactttctttcaaaaggttgccgagctacacgccagaatgtgg
aagatcaacaagggcttaactgatcatcatgtctatgaatccagtccagattcttggccc
ttcctgctcagaggtataagctactggtcaaaaaatcactcacaaatttatttcataggt
aatgctgtcacttggtggacagtcaccgcaagtattgctttgttctctgtctttttggtt
ttctctattctgagatggcaaagaggttttgggttcagcgttgacccaactgtgttcaac
ttcaatgttcaaatgcttcattacatcctaggatgggtactgcattacttgccatctttc
cttatggcccgtcagctatttttgcaccactatctaccatcattgtactttggtatattg
gctctcggacatgtgtttgagattattcactcttatgtcttcaaaaacaaacaggttgtg
tcttactccatattcgttctcttttttgccgttgcgctttctttcttccaaagatattct
ccattgatctatgcaggacgatggaccaaggaccaatgcaacgaatccaagatactcaag
tgggactttgactgtaacaccttccccagtcacacatctcagtatgaaatatgggcatcc
cctgtacaaacttccactcctaaagaaggaacccactcagaatctaccgtcggagaacct
gacgttgagaagctgggagagacagtctaa

DBGET integrated database retrieval system