KEGG   Pichia pastoris: PAS_chr2-1_0269Help
Entry
PAS_chr2-1_0269   CDS       T01092                                 

Definition
Threonine synthase, conserved protein that catalyzes formation of threonine from 0-phosphohomoserine
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppa  Pichia pastoris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAS_chr2-1_0269
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr2-1_0269
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAS_chr2-1_0269
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAS_chr2-1_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:507151..508659
Genome map
AA seq 502 aa AA seqDB search
MSVYRSTRSSAEQQVSFEDAVITGLAKDGGLFIPSEIPSVPTDFLSAWKDLSFQDLAFKI
MRLYIKEAEIPDNDLKDLVERSYSTFRSEEVTPTVKLDSHDNLFLLELFHGPTYAFKDVA
LQFVGNLFEYFLQRKNKGKAEDDPTRDTITVVGATSGDTGSAAIYGLRNKKDVSVFILYP
TGRISPIQELQMTTVVDDNIHTLSVNGTFDDCQALVKEVFNDSEFNDKWHIGAINSINWA
RILAQITYYFYSYLQVSQAVGHGRVKFIVPSGNFGDILAGFYASQMGLPVEKLVVATNEN
DILNRFLTTGKYDKGDVKPTHSPAMDIVVSSNFERFLWYMIKETIGKNDEKATGEILNNY
MKELSTKGVFTVPQAVLDKATSILDSDRITNEETVSTIKKIYEATSNNYIIDPHTSVGIA
TTLNQIKKDNDPSITYVSLSTAHPAKFSEVVDAALTSYPDYSFEKDVLPEELKNLSTLPK
KIKLIETATLESIKDTIVKTLS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctacagatcaactcgttcaagtgccgaacagcaagtctcatttgaagacgcc
gtcatcactggtttggccaaagatggtggtttattcatcccatccgagattccatctgtc
ccaactgatttcctgtcagcttggaaagatttgagttttcaagatttagccttcaagatc
atgagattgtatattaaggaggctgaaatcccagataatgatttgaaagatcttgttgag
agatcctattcaactttcaggtcggaagaggtcactccgaccgttaaattagattcacat
gacaacttgttcttgttggaactgttccatgggcccacttatgcctttaaggatgttgcc
ttgcaatttgtaggtaacttgttcgaatacttcttgcaaaggaaaaataagggcaaagct
gaagatgatccaaccagagataccattacagtagtcggtgctacttctggtgatactgga
tctgctgctatctatggactgagaaataaaaaggacgtatccgtattcatcctttacccc
acaggaagaattagtcctattcaagaattgcagatgaccaccgttgttgatgacaatatc
cacactttgtccgtgaatggtacatttgatgattgtcaggcgttggtcaaggaagtgttt
aacgattccgagttcaatgataaatggcacatcggagcgatcaactccatcaactgggct
cgtatcttggctcaaataacttactacttctactcgtaccttcaagtctcccaagcagtt
ggccatggtagagtcaagtttatcgttcctagtggaaattttggagacatcttggcagga
ttttacgcctctcaaatgggcctgccagttgagaaattggtagttgccacgaacgagaac
gatatcttgaacagattccttactactggtaaatatgacaagggagatgttaaaccaacg
cattctccagccatggacattgttgtttcatctaactttgagagattcttatggtatatg
atcaaggaaacaattggtaagaacgatgagaaggccactggtgaaattctaaacaactac
atgaaagagttatctaccaaaggtgtgtttactgtgcctcaagcagttcttgataaggcc
accagtattctggacagtgacagaatcaccaacgaggaaactgtttccaccatcaaaaag
atctatgaagccacttccaataactacattatcgatccccacacttctgttggtattgcc
actaccttgaaccaaattaagaaagacaatgatccttctattacatacgtctcgttgtca
actgctcatcctgccaagttcagcgaagtagttgatgcagctttgaccagttatcctgac
tacagctttgaaaaagatgttttgccagaagagttgaagaatctctcaaccttgccaaag
aagataaaactaattgaaactgccactttggagtcaatcaaggacactatcgttaaaact
ttgagctag

DBGET integrated database retrieval system