KEGG   Komagataella phaffii: PAS_chr2-1_0269Help
Entry
PAS_chr2-1_0269   CDS       T01092                                 

Definition
(RefSeq) Threonine synthase, conserved protein that catalyzes formation of threonine from 0-phosphohomoserine
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00260  Glycine, serine and threonine metabolism
ppa00750  Vitamin B6 metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01230  Biosynthesis of amino acids
Module
ppa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr2-1_0269
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAS_chr2-1_0269
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAS_chr2-1_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Stevor
Motif
Other DBs
NCBI-GeneID: 8198818
NCBI-ProteinID: XP_002491161
UniProt: C4R057
Position
2:507151..508659
Genome map
AA seq 502 aa AA seqDB search
MSVYRSTRSSAEQQVSFEDAVITGLAKDGGLFIPSEIPSVPTDFLSAWKDLSFQDLAFKI
MRLYIKEAEIPDNDLKDLVERSYSTFRSEEVTPTVKLDSHDNLFLLELFHGPTYAFKDVA
LQFVGNLFEYFLQRKNKGKAEDDPTRDTITVVGATSGDTGSAAIYGLRNKKDVSVFILYP
TGRISPIQELQMTTVVDDNIHTLSVNGTFDDCQALVKEVFNDSEFNDKWHIGAINSINWA
RILAQITYYFYSYLQVSQAVGHGRVKFIVPSGNFGDILAGFYASQMGLPVEKLVVATNEN
DILNRFLTTGKYDKGDVKPTHSPAMDIVVSSNFERFLWYMIKETIGKNDEKATGEILNNY
MKELSTKGVFTVPQAVLDKATSILDSDRITNEETVSTIKKIYEATSNNYIIDPHTSVGIA
TTLNQIKKDNDPSITYVSLSTAHPAKFSEVVDAALTSYPDYSFEKDVLPEELKNLSTLPK
KIKLIETATLESIKDTIVKTLS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctacagatcaactcgttcaagtgccgaacagcaagtctcatttgaagacgcc
gtcatcactggtttggccaaagatggtggtttattcatcccatccgagattccatctgtc
ccaactgatttcctgtcagcttggaaagatttgagttttcaagatttagccttcaagatc
atgagattgtatattaaggaggctgaaatcccagataatgatttgaaagatcttgttgag
agatcctattcaactttcaggtcggaagaggtcactccgaccgttaaattagattcacat
gacaacttgttcttgttggaactgttccatgggcccacttatgcctttaaggatgttgcc
ttgcaatttgtaggtaacttgttcgaatacttcttgcaaaggaaaaataagggcaaagct
gaagatgatccaaccagagataccattacagtagtcggtgctacttctggtgatactgga
tctgctgctatctatggactgagaaataaaaaggacgtatccgtattcatcctttacccc
acaggaagaattagtcctattcaagaattgcagatgaccaccgttgttgatgacaatatc
cacactttgtccgtgaatggtacatttgatgattgtcaggcgttggtcaaggaagtgttt
aacgattccgagttcaatgataaatggcacatcggagcgatcaactccatcaactgggct
cgtatcttggctcaaataacttactacttctactcgtaccttcaagtctcccaagcagtt
ggccatggtagagtcaagtttatcgttcctagtggaaattttggagacatcttggcagga
ttttacgcctctcaaatgggcctgccagttgagaaattggtagttgccacgaacgagaac
gatatcttgaacagattccttactactggtaaatatgacaagggagatgttaaaccaacg
cattctccagccatggacattgttgtttcatctaactttgagagattcttatggtatatg
atcaaggaaacaattggtaagaacgatgagaaggccactggtgaaattctaaacaactac
atgaaagagttatctaccaaaggtgtgtttactgtgcctcaagcagttcttgataaggcc
accagtattctggacagtgacagaatcaccaacgaggaaactgtttccaccatcaaaaag
atctatgaagccacttccaataactacattatcgatccccacacttctgttggtattgcc
actaccttgaaccaaattaagaaagacaatgatccttctattacatacgtctcgttgtca
actgctcatcctgccaagttcagcgaagtagttgatgcagctttgaccagttatcctgac
tacagctttgaaaaagatgttttgccagaagagttgaagaatctctcaaccttgccaaag
aagataaaactaattgaaactgccactttggagtcaatcaaggacactatcgttaaaact
ttgagctag

DBGET integrated database retrieval system