KEGG   Pichia pastoris: PAS_chr2-1_0302Help
Entry
PAS_chr2-1_0302   CDS       T01092                                 

Definition
Putative catalytic subunit of a class II histone deacetylase complex
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PAS_chr2-1_0302
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAS_chr2-1_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(561226..563451)
Genome map
AA seq 741 aa AA seqDB search
MEILKEEATESNGKRKLEEESDALQLSKQEGEGHLSGLPPSGKWDDNQIVNGSVIVPVVE
PKLRYITLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPTL
SGIDQIGDYMLKIPVREATAEEILLVHSEEHLKFIESTSSMSRERLLEETEKGDSVYFNH
DSLLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPDSPGGFCLFSNVAVAAKNI
LRNYPESVRKIVVLDWDVHHGNGTQKAFWEDPRVLYISLHRYEQGKYYPGTKAGGADQCG
ENEGLGKNINIPWPVGGMNDADYLYAFRKVVMPVCREYAPDLLIISSGFDAAEGDIIGGC
HISPAGYSQMTHMLKSLARGNVCVVLEGGYNLDSIANSALSVTKVLLGESPEEPKVTVPS
AHAIEVIDDVIKIQSQYWKTLQPAYTGICFTNPSIMGNYSLLVNPATEKKVLSDLAVNPR
LCDAVRNSQAQYLSSKFGFINLPVVSGKGLTSPSLDNQVLSTKDIFQANTIIIVIHDPSD
VWARQDPRSGLLDLSGSMIVDTSSKFVEWAVNLKYGVIDINVPLTLTGKDDETYNNVTAS
QELLLYIWDNYIQYFPVTKIALVGFGDAYNGVIHLCGHREVRSIVKASINFLDRTPLRAI
VSSIDESVTDWFYKNSLVFTSTRHPCWGEQGTSEMKRPRKKYGRVLKADIDGLPNIVDER
FEETTDFILDSIEEYEDESSN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttaaaagaagaagcgacggaaagcaacggtaaaagaaagctcgaggaggaa
agtgatgccttgcaattgtccaaacaagaaggtgagggccatctttccggattacctccc
tcaggtaaatgggacgataaccaaatcgttaacgggtcggtaattgtccccgtggtagaa
cctaaacttagatatattacgctcaagactggtttatgttatgatgtgcgcatgaggtat
catgccaaaattttcacgtcctactttgagtacatcgatccacaccctgaagaccctaga
aggatatatcgtatttataagatactagcagaaaatgggcttatcacagatccaacgctg
tctggaatagatcaaatcggtgactatatgctcaaaatccctgttagagaagccacggcg
gaggaaattctattggtacattcagaagagcatttgaaatttatagagagtacttcaagc
atgtccagagagaggcttctagaggaaacggaaaaaggggattcggtgtacttcaaccat
gattctttgctaagtgctaagttatcttgtgggggagccattgaagcgtgtaaggcagtc
gtcgaaggaagggttaagaatgccctcgctgtggtcaggcctccagggcatcatgcagag
ccagactccccaggaggattctgccttttttccaatgtcgccgtagctgccaaaaacatt
ctcaggaactaccctgaatcggtcagaaaaatagtagttctcgattgggatgttcatcat
ggaaacggtacccaaaaggctttttgggaagaccccagagttctatatatctctctgcat
cgttacgagcagggcaaatactaccctgggacaaaagctggaggagctgatcaatgtgga
gaaaatgaaggtttagggaaaaacatcaacatcccttggcctgttggaggtatgaacgac
gctgattacctctatgcctttagaaaagttgtcatgcctgtttgcagggaatacgcaccc
gacttgctaatcatttcctctgggtttgacgctgctgaaggagatatcattgggggatgt
catatatcgcccgctggttacagtcaaatgacccacatgctaaagtcccttgcacgggga
aacgtgtgtgttgttctagaaggtggatataacctggattcgatagcaaactctgcatta
agtgttaccaaagtgctcttgggtgaatcacctgaagaacccaaagtcacagtaccaagt
gctcatgctattgaagtcatagatgatgtcatcaaaattcaatctcagtattggaaaact
ctccaacccgcatacacaggaatatgttttacaaacccttcaattatgggtaattactct
ttactagtaaatccagccactgaaaagaaagttctcagcgatctcgcagttaatccaaga
ctatgcgatgctgttagaaattcccaagctcagtatttgtcgtccaagtttggtttcatt
aatctgccagttgtttcaggcaaaggattgacttctccatctctggataaccaggttctg
tcaacaaaggacatcttccaagccaataccataataatagtaatacacgatccatccgat
gtatgggccagacaagacccgaggtctggactgctggatctctccgggtctatgatagtc
gacacctcttctaaattcgttgaatgggctgtgaacttgaaatatggagttatagatata
aatgttccattgacattgacaggcaaggatgatgaaacatacaacaacgttacagcttct
caggagctactcctttatatttgggacaattacattcagtactttccagttacaaaaatt
gcacttgttggattcggtgatgcttacaatggagtcatacacctttgtggtcatcgagaa
gtccgcagcatagtgaaagcttctatcaacttcctggatagaactccgttacgtgctatt
gtttccagcatagatgaatctgtcactgactggttttataaaaactcactagttttcact
agtactaggcatccttgttggggagaacagggaaccagtgaaatgaagagacctcgtaaa
aagtatggtagagtgctgaaggctgacatagatggactgccaaatattgttgatgaaaga
tttgaggaaactaccgactttattttagactccatcgaagaatacgaagatgagagttct
aactaa

DBGET integrated database retrieval system