KEGG   Pichia pastoris: PAS_chr2-1_0302Help
Entry
PAS_chr2-1_0302   CDS       T01092                                 

Definition
Putative catalytic subunit of a class II histone deacetylase complex
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ppa  Pichia pastoris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(561226..563451)
Genome map
AA seq 741 aa AA seqDB search
MEILKEEATESNGKRKLEEESDALQLSKQEGEGHLSGLPPSGKWDDNQIVNGSVIVPVVE
PKLRYITLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPTL
SGIDQIGDYMLKIPVREATAEEILLVHSEEHLKFIESTSSMSRERLLEETEKGDSVYFNH
DSLLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPDSPGGFCLFSNVAVAAKNI
LRNYPESVRKIVVLDWDVHHGNGTQKAFWEDPRVLYISLHRYEQGKYYPGTKAGGADQCG
ENEGLGKNINIPWPVGGMNDADYLYAFRKVVMPVCREYAPDLLIISSGFDAAEGDIIGGC
HISPAGYSQMTHMLKSLARGNVCVVLEGGYNLDSIANSALSVTKVLLGESPEEPKVTVPS
AHAIEVIDDVIKIQSQYWKTLQPAYTGICFTNPSIMGNYSLLVNPATEKKVLSDLAVNPR
LCDAVRNSQAQYLSSKFGFINLPVVSGKGLTSPSLDNQVLSTKDIFQANTIIIVIHDPSD
VWARQDPRSGLLDLSGSMIVDTSSKFVEWAVNLKYGVIDINVPLTLTGKDDETYNNVTAS
QELLLYIWDNYIQYFPVTKIALVGFGDAYNGVIHLCGHREVRSIVKASINFLDRTPLRAI
VSSIDESVTDWFYKNSLVFTSTRHPCWGEQGTSEMKRPRKKYGRVLKADIDGLPNIVDER
FEETTDFILDSIEEYEDESSN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttaaaagaagaagcgacggaaagcaacggtaaaagaaagctcgaggaggaa
agtgatgccttgcaattgtccaaacaagaaggtgagggccatctttccggattacctccc
tcaggtaaatgggacgataaccaaatcgttaacgggtcggtaattgtccccgtggtagaa
cctaaacttagatatattacgctcaagactggtttatgttatgatgtgcgcatgaggtat
catgccaaaattttcacgtcctactttgagtacatcgatccacaccctgaagaccctaga
aggatatatcgtatttataagatactagcagaaaatgggcttatcacagatccaacgctg
tctggaatagatcaaatcggtgactatatgctcaaaatccctgttagagaagccacggcg
gaggaaattctattggtacattcagaagagcatttgaaatttatagagagtacttcaagc
atgtccagagagaggcttctagaggaaacggaaaaaggggattcggtgtacttcaaccat
gattctttgctaagtgctaagttatcttgtgggggagccattgaagcgtgtaaggcagtc
gtcgaaggaagggttaagaatgccctcgctgtggtcaggcctccagggcatcatgcagag
ccagactccccaggaggattctgccttttttccaatgtcgccgtagctgccaaaaacatt
ctcaggaactaccctgaatcggtcagaaaaatagtagttctcgattgggatgttcatcat
ggaaacggtacccaaaaggctttttgggaagaccccagagttctatatatctctctgcat
cgttacgagcagggcaaatactaccctgggacaaaagctggaggagctgatcaatgtgga
gaaaatgaaggtttagggaaaaacatcaacatcccttggcctgttggaggtatgaacgac
gctgattacctctatgcctttagaaaagttgtcatgcctgtttgcagggaatacgcaccc
gacttgctaatcatttcctctgggtttgacgctgctgaaggagatatcattgggggatgt
catatatcgcccgctggttacagtcaaatgacccacatgctaaagtcccttgcacgggga
aacgtgtgtgttgttctagaaggtggatataacctggattcgatagcaaactctgcatta
agtgttaccaaagtgctcttgggtgaatcacctgaagaacccaaagtcacagtaccaagt
gctcatgctattgaagtcatagatgatgtcatcaaaattcaatctcagtattggaaaact
ctccaacccgcatacacaggaatatgttttacaaacccttcaattatgggtaattactct
ttactagtaaatccagccactgaaaagaaagttctcagcgatctcgcagttaatccaaga
ctatgcgatgctgttagaaattcccaagctcagtatttgtcgtccaagtttggtttcatt
aatctgccagttgtttcaggcaaaggattgacttctccatctctggataaccaggttctg
tcaacaaaggacatcttccaagccaataccataataatagtaatacacgatccatccgat
gtatgggccagacaagacccgaggtctggactgctggatctctccgggtctatgatagtc
gacacctcttctaaattcgttgaatgggctgtgaacttgaaatatggagttatagatata
aatgttccattgacattgacaggcaaggatgatgaaacatacaacaacgttacagcttct
caggagctactcctttatatttgggacaattacattcagtactttccagttacaaaaatt
gcacttgttggattcggtgatgcttacaatggagtcatacacctttgtggtcatcgagaa
gtccgcagcatagtgaaagcttctatcaacttcctggatagaactccgttacgtgctatt
gtttccagcatagatgaatctgtcactgactggttttataaaaactcactagttttcact
agtactaggcatccttgttggggagaacagggaaccagtgaaatgaagagacctcgtaaa
aagtatggtagagtgctgaaggctgacatagatggactgccaaatattgttgatgaaaga
tttgaggaaactaccgactttattttagactccatcgaagaatacgaagatgagagttct
aactaa

DBGET integrated database retrieval system