KEGG   Komagataella pastoris: PAS_chr2-1_0402Help
Entry
PAS_chr2-1_0402   CDS       T01092                                 

Definition
Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppa  Komagataella pastoris
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr2-1_0402
   01230 Biosynthesis of amino acids
    PAS_chr2-1_0402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr2-1_0402
   00030 Pentose phosphate pathway
    PAS_chr2-1_0402
   00051 Fructose and mannose metabolism
    PAS_chr2-1_0402
   00052 Galactose metabolism
    PAS_chr2-1_0402
  Energy metabolism
   00680 Methane metabolism
    PAS_chr2-1_0402
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PAS_chr2-1_0402
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAS_chr2-1_0402
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAS_chr2-1_0402
Messenger RNA biogenesis [BR:ppa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAS_chr2-1_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:739529..742498
Genome map
AA seq 989 aa AA seqDB search
MPEPSISALSFTSFVTNDDKLFEETFNFYTKLGFHATRSYVKDNRSDFELTGISTDSIKE
IWLESFPLSEVVETSAGRELRKPLQESVGYQSEALLGYSPYQSDGVVIKLRLSNHDLQKN
KDLPGEVTFFTASIDKLRAKLIEIGAEIIPSEIDLVEFSTKDPMGDVISFSSYPSLSSKK
ITSPDFFLHPKKEVRSQESIVEQVKSEEGKKKIAIITSGGDAPGMNAAVRAVTRAGIFYG
CKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGGTIIGTARSKEFRERWGRLQACYNM
VSNGIDALVVCGGDGSLTGADLFRNEWPELIKELLGEGKITKEQYETHRNLTIVGLVGSI
DNDMCGTDSTIGAYSSLERIIELVDYIDATAASHSRAFVVEVMGRHCGWLGLMSGIATGA
DYIFIPERPPSETNWKDDLKKVCLRHREKGRRKTTVIVAEGAIDDQLNPITSEEVKDVLV
EIGLDTRITRLGHVQRGGAPCAFDRFLATVQGVDAVRAVLESTPAIPSPVISILENKIVR
QPLVESVAQTKTVSDAIEAKDFDKALKLRDQEFATSYESFLSVSKYDDGSYLVPESSRLN
IAIIHVGAPTSALNPATRVATLNSLAKGHRVFAIRNGFAGLIRHGAVRELNWIDVEDWHN
TGGSEIGTNRSLPSDDMGTVAYYFQQYKFDGLIIIGGFEAFTALYQLDAARAQYPIFNIP
MCCLPATVSNNVPGTEYSLGSDTCLNTLSGYCDAVKQSASASRRRTFVVEVQGGYSGYLA
SYAGLITGALAVYTPENPINLQTVQEDIELLTRTYEEDDGKNRSGKIFIHNEKASKVYTT
DLIAAIIGEAGKGRFESRTAVPGHVQQGKSPSSIDRVNACRLAIKCCNFIEDANFQVKHN
ANLSADERHLRFFYDDGVKTSAVSGKSSVIDDNTSVVIGIQGSEVTFTPVKQLWEKETHH
KWRKGKNVHWEQLNIVSDLLSGRLSIRTT
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaccatctataagtgcactttccttcacttcgtttgtcactaatgatgacaaa
ctgtttgaagagactttcaatttttacacgaagttgggcttccacgcaacacgctcatat
gttaaagacaaccggtcagactttgaattgacggggatttccacggattcaatcaaggaa
atctggctggaaagtttcccactatctgaagtggtcgaaacgtcagctggtagagagttg
agaaaaccactgcaagaatctgtgggctaccaatctgaagctcttctgggatattctccc
taccagagtgacggtgttgttataaaattaaggttatcaaatcatgaccttcagaaaaac
aaagacttgcccggtgaagttacgtttttcaccgctagtatcgacaaattaagagctaaa
ctcattgaaattggtgctgagataattccctcagaaatagaccttgttgaattttcaacc
aaggatcctatgggcgacgtcattagcttttcttcttatccctctttgagttccaagaag
attacctctccagactttttcctccaccctaagaaggaagtacgctcccaagaatcaata
gttgagcaggttaaatctgaagaaggtaagaagaagattgccatcataacttcaggtgga
gacgcaccgggaatgaatgctgcagtaagggctgtgacaagagccggtattttctatggc
tgtaaagtttacgcttgttatgaaggttacactggactggttaagggtggtgatatgtta
aaggaactgcagtggcaagatgtccgtggtttactttccattggtggtaccataattggt
actgcaagaagtaaggaattcagagaacgatggggccgtcttcaagcttgctacaatatg
gtcagcaatggtattgatgcgttagttgtttgtggaggtgacggatctcttacaggtgcc
gatctatttcgaaatgaatggcctgaactgataaaggaacttttgggtgagggcaaaatt
acaaaagaacaatatgaaacacacagaaacttgacaatcgtaggtctcgttggttctatc
gataacgatatgtgcggaactgattccacaattggtgcttattcctcattggagagaatc
atagagctggtagactacatcgatgctactgccgcctcccattcacgagccttcgtggtg
gaagtcatgggtagacattgtggatggttaggtttaatgtccggaattgctactggagct
gattacattttcatccctgaaagacctccaagtgaaacaaactggaaggacgacttgaag
aaagtctgtttgagacatagagagaaaggacgcaggaagaccaccgttattgttgctgaa
ggtgctattgatgaccaactgaaccctatcacttctgaagaggtgaaagatgtactagtg
gagattggtttggacactcgtattacccgtctaggacatgtccaaagaggtggagctccg
tgtgcttttgatagattcttggccactgttcaaggtgttgatgctgttagggctgtttta
gaaagcaccccagcaattccttctcctgtcatcagcattttggagaacaaaattgttcgc
cagccgttggtggaatctgttgctcaaacaaagactgtcagtgatgctatcgaggccaag
gatttcgataaagctttgaaattaagagaccaagagtttgccacatcatatgagagcttc
ctgtccgtttccaagtatgacgatggatcatatctagtaccagagagctcaagattaaat
attgccatcatccatgtgggagctccaacatctgcgttgaatcctgccacaagagttgct
actttgaactcgttggcaaaaggacacagagtttttgctattcgaaacggatttgcagga
ttaattcgccacggcgctgtacgagagctcaactggattgatgttgaggactggcacaac
acaggtgggtcggagattggtaccaacagaagtcttcctagtgatgatatgggcactgtg
gcgtactacttccagcaatacaagtttgatggtcttattattatcggtggatttgaagct
ttcacagctctgtaccagctggacgcagctcgtgctcagtatcctatcttcaatattcca
atgtgttgtcttccagctactgtttctaataacgttcctggtaccgagtattccttaggg
tctgacacatgtctaaacaccttgtctggatactgtgatgctgtgaaacaatctgcttct
gctagtagaagaagaacatttgttgtggaagttcaaggtggatactcaggatatcttgcc
agctacgctggtctgatcacaggagctttggctgtttatactcctgaaaacccaatcaac
cttcaaacagtgcaggaagacattgaattgttgactcgaacatacgaggaagacgatggt
aagaacagatcgggtaaaatctttattcataatgaaaaggcttcaaaggtttacaccacg
gatctgattgctgctatcataggtgaagctggaaagggtaggtttgagagccgtactgcc
gtgcctggtcatgtacaacagggtaaatctccctcatctattgaccgggttaatgcctgc
agactggctatcaaatgttgtaacttcatcgaggacgccaatttccaggtgaaacacaat
gccaatttgagcgccgacgaacgtcatttgagattcttttacgatgacggagttaagaca
tctgcagtgagcggcaaatcttccgtgatagatgataacacgtcagtggtcattggaatc
caaggttccgaggttacattcactcctgtaaaacagctatgggagaaggaaactcatcat
aagtggcgaaagggtaagaacgttcattgggagcagttgaacattgtctctgacctcttg
agtggtcgtttgtctattcgtaccacgtaa

DBGET integrated database retrieval system