KEGG   Pichia pastoris: PAS_chr2-1_0422Help
Entry
PAS_chr2-1_0422   CDS       T01092                                 

Definition
Acireductone dioxygenease involved in the methionine salvage pathway
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppa  Pichia pastoris
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAS_chr2-1_0422
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PAS_chr2-1_0422
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PAS_chr2-1_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:775912..776439
Genome map
AA seq 175 aa AA seqDB search
MQLYYHDGLDTPDNFCEDHNSGEEVSVEELSKIGVIYYHLDEESQVEKIARERDYKNRDF
VVLSDETFPGGPDALQEKLKVFYKEHLHEDEEIRFILDGEGYFDVRSQNDRWIRSKLFKG
DLLILPAGIYHRFTLSTKKYVKTMRLFKEEPKWQAYNRPADDKGARLEYLKSIQV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttactatcatgatggtttagacaccccagataatttctgtgaagatcacaat
tctggggaagaggtgtcagttgaagagctgtccaaaattggagtgatatactaccatttg
gacgaagagagtcaagttgagaagattgccagggaaagagattacaagaacagagatttt
gtggttctatctgatgagactttccctggtgggccagatgctttgcaagagaaactgaaa
gtcttctacaaggagcatcttcacgaagatgaggagattagattcatcctggatggagaa
ggctactttgacgtgagatcacagaacgacaggtggatccgaagcaagcttttcaaaggt
gatttactgattcttcctgctgggatttaccacagattcacgttgtccactaagaagtat
gtcaagacaatgaggttgttcaaggaggagccaaaatggcaagcctataacagaccggct
gatgacaaaggagctagattggagtacttgaaaagtattcaggtgtag

DBGET integrated database retrieval system