KEGG   Komagataella pastoris: PAS_chr2-1_0428Help
Entry
PAS_chr2-1_0428   CDS       T01092                                 

Definition
One of two nearly identical (see HTB1) histone H2B subtypes
Orthology
K11252  
histone H2B
Organism
ppa  Komagataella pastoris
Brite
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAS_chr2-1_0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(786382..786780)
Genome map
AA seq 132 aa AA seqDB search
MAPKAEKKPASKAPAEKKPTAGKKTSSSSEPKKRSKVRKESYASYIYKVLKQTHPDTGIS
QKAMSIMNSFVNDIFERIASEASKLASYNKKSTISAREIQTAVRLILPGELSKHAVSEGT
RAVTKYTSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaagcagagaagaaaccagcctctaaggccccagctgagaagaagcctact
gccggaaagaagacttcttcttcttccgaaccaaagaagagatctaaggttagaaaggag
tcttacgcttcctacatctacaaggttttgaagcagactcaccctgacaccggtatctct
cagaaggccatgtctatcatgaactctttcgtcaacgacatcttcgagagaattgcttct
gaagcttccaagttggcttcttacaacaagaagtctaccatctctgcaagagagatccag
accgctgttagactgattcttccaggtgaattgtctaagcacgccgtctctgaaggtact
cgtgccgttaccaaatacacctcatcaacccaggcttaa

DBGET integrated database retrieval system