KEGG   Komagataella pastoris: PAS_chr2-1_0459Help
Entry
PAS_chr2-1_0459   CDS       T01092                                 

Definition
Subunit of TORC1, a rapamycin-sensitive complex involved in growth control
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ppa  Komagataella pastoris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(844395..848588)
Genome map
AA seq 1397 aa AA seqDB search
MRHGFQDEYTSQQYMDMLANTFYIYYDDKRHETAGNPTTEEEKEKNYKKYQPIVDWKIMK
DRQKTVSAAIVLCLNIGVDPPDILKTQPSAKTEAWVDPLSFTDNKKAIESIGRALQTQYE
TLSLRTRYKQSLDPCVEDVKRFCNTLRKTAKDERILFHYNGHGVPQPTQSGEIWVFNRGY
TQYIPISLYDLQTWLGAPCIFVYDCSSAGNIVTNFKKFVQKRIDDDNDGNHDISAPSPTA
AYIDCIQLAACKSSEILPMNPDLPADLFTCCLTCPIEISVKWFLLQSPLKFHGYYDLLLD
QNGQIQIPGKLTDRRTPLGELNWIFTAITDTIAWSSLPRAVFKKLFRQDLMVAALFRNFL
LAKKIMTANGCNPISDPPLPDITDHTMWDSWDLAIDQVLSQLVKNHEKLSRDPTASANTL
LRTEPNSVAPTPVSTTTSLSDSQDGNQTPQKPPAPAPSQSQGQIINNYQHSTFFEHHLTA
FEIWLKYGSSSKDPPDQLPIVLQVLLSQVHRLRALILLSRFLDLGPWAVYLALSIGIFPY
ILKLLQSPAQELKPVLTFIWARIMSIDHKNTQQELCKDKGYNYFIQILVAPKPTTAASGN
HFLVNDVNYEEHKAMSAFILSLFVKEYKPGQRLCFSSDLVGTCLYYLEKSGHPLLRQWCA
LFTGQLWANYPDGRWISYKDGHVERLTKLLNDPIPEVRASIVISLTNFLTTLSDDEEPST
MMMGKEESNQQEVKVALSMLFLLADGSPIVRREVVVFFSKFVMKYIHFFIVSACGQLEEE
ITLIDDPSMIDEVRRRSINYGTIYSSVFKTLLIMSSDPDDGVKDYAQSLVDFIMIKLNQS
PLGEIVCDMEQYLLQRSSTNDTTQLKSDQASLHGLGMVSNGNQLKIHKTRDPSHSKTGSR
SQSLKITSNKNSTTITPLFEGNQQNGHNQRSVSNVSTSSLTDRMSNLALNWLRNFSGASN
RNIQDHDSQLAPVDLSHLYLGYGIEPIPPTPRFVPLKQLSPISEPTMPLHSKFFEYSMEY
FQEPQIGVNDVDEPGSFEYTRRLWRRNRNESIINETQPQKDLAISGDWNNNIATFNNTTQ
PKLLKFTQFDSYLVSADEKDNITCFNWETNEQLSRFSNNNPFGTKITDMKFINEDDNAML
LTGSSDGVVRIYKNFQSMEDIRLATAWRALTDLLLTSRTTGLVSEWQQSTGSLLVSGDVK
IIRIWDAPRELCVVDIPARSTSSITSLTSDQVAGNIFVGGFGDGTIRVYDRRLDSRDSMV
KIWQNRESRGMIKNVHMQRGGHRELMSASNNMVNLWDIRLDKPIESFPHRSITASLIHEH
APVILTASKIVNVATTTGEHVSTIRDPSPYLSNKTAGYVSSMMLHPHRMMVATSHTQDSH
IQLYKCTDKLVQEHDGY
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atgcggcatggatttcaagatgagtacacatctcagcagtacatggacatgttggccaat
actttctacatctattatgacgacaagaggcatgagacggcgggaaacccaactacagaa
gaagagaaggaaaaaaattacaaaaaataccaacccattgtcgattggaagatcatgaaa
gaccgacagaagactgttagtgcagctattgtgttatgtctgaacattggagttgaccct
cctgatatcctcaagactcaaccttctgctaaaacagaggcttgggtagatcctctgtcg
ttcacagataataagaaggctattgaatccattgggagagcgctgcaaacacagtatgag
accttatctttgagaactcgctacaagcaatctctagatccatgtgttgaagacgtgaaa
cgattttgcaacactctaagaaagactgccaaagatgagcgtatcttatttcattacaat
ggccacggagtcccacaacctacgcagagtggagaaatttgggtgtttaacagaggatac
actcagtatattcctatttcattgtacgatttgcagacatggcttggagctccttgcatc
tttgtgtacgattgttcttccgctggaaacatagtgaccaacttcaagaaatttgttcag
aaaagaatcgacgacgataatgacggaaaccatgatatcagtgctccttcacccactgct
gcctacattgattgtatccagctagctgcgtgtaagtccagcgagattctgcccatgaat
ccagaccttccagcagatttgtttacgtgttgcttaacatgcccaatcgagatcagtgta
aaatggtttctcctacagtcccctttgaaatttcatggctattatgaccttttgttggat
cagaatggacagatacagattcctggtaaactcacggatagaaggaccccactgggagaa
ttaaattggattttcacagccataactgatacgattgcatggtccagtcttccaagagct
gtgttcaagaaacttttccggcaagacttgatggttgctgcattgtttagaaattttctc
cttgcaaagaaaattatgacagcaaatggttgtaatcccatctcagatcctccattaccg
gatatcactgatcatacaatgtgggactcttgggatctcgctatcgatcaagtcttgtct
caattggtgaagaatcatgaaaaattatctcgagatcctactgcttcagctaacacatta
ttgagaacagagcccaattctgttgctcccacacccgtatctactactacatcattatca
gactctcaagatggaaatcagaccccccaaaagcctccagctccagcaccaagtcaatca
caaggtcaaataattaataattaccagcattccacattctttgaacatcacttgactgct
tttgagatttggttgaaatatggttcaagttccaaagatcccccagatcagctgccaatt
gttttacaggtattgctatcacaagttcacagattgagagctttaattttactttcaaga
ttcttggatctaggtccatgggcagtttatttggccctgtctattggtattttcccttac
attttaaagcttttgcagagtccagcacaggaacttaagccggttctaacttttatttgg
gccaggataatgtcaattgatcataagaatactcagcaggaattatgcaaagataaagga
tacaattattttatccaaattctggtggctcccaaacctacgactgctgctagtggaaac
cactttttggtcaatgacgtcaactatgaagagcataaagcgatgtctgcattcattctt
tccctttttgtgaaggagtacaaacctggtcagcggctttgcttcagctcagaccttgtt
ggtacatgtttgtattaccttgaaaaatcaggacatcctctacttagacaatggtgtgca
ctttttacaggccagttatgggccaattatcccgatggacgatggatttcttataaagat
ggacatgttgagcgtttaactaaactgttgaacgatccgattcctgaggtcagagcttcc
attgtaatttcgttgaccaactttctgacaacgctatctgatgatgaagaaccgtccaca
atgatgatgggtaaagaagagtcgaaccagcaagaggtaaaagttgcattgtcaatgctt
ttcctattggcggatggatctcccattgttcgtcgggaagttgtcgtctttttttccaag
ttcgttatgaagtatatccattttttcattgttagtgcatgtggtcaattagaggaggaa
ataactctaattgatgatcccagcatgattgacgaagttaggagaagaagtattaactat
ggaaccatctacagttctgtattcaaaacgctactgattatgagttctgatcctgacgat
ggagtaaaagattatgcgcagagtttggtagattttattatgatcaaattgaatcaaagt
ccccttggtgagattgtctgtgatatggaacaatatttactacaacgaagttcaaccaat
gacacgacccagttgaaatcagatcaagccagcttgcatggattggggatggtatccaat
ggaaaccaacttaaaatccataagacgagagatcctagccattcaaagacaggcagccgg
tctcaatcactaaaaattacttcaaataagaattctacgaccataacaccattatttgaa
ggaaaccaacaaaatggacataatcaaagatctgtctccaacgtctcaaccagttcactt
actgataggatgagtaatctcgcattaaattggctgcgaaacttttctggtgctagcaac
agaaatatccaagatcatgactctcagttggccccagtggatctttcacatttgtatctc
ggatatggtatcgagcccattcctcctacacctaggtttgttcctttgaaacaattgagt
ccaatcagcgaaccaacaatgcccttacatagtaaattctttgagtacagcatggaatac
tttcaagagcctcaaattggtgtgaatgatgtggatgaaccaggaagttttgagtacacc
aggagactttggagaaggaaccggaacgagtcaattattaatgaaacacaaccacaaaag
gatttggctatttcaggggattggaacaacaatattgctacattcaacaataccactcag
ccaaaactgttaaaatttacacaatttgatagctatcttgtatctgctgatgagaaagac
aatattacatgtttcaactgggaaaccaatgaacaattatccaggttttctaataacaac
ccatttggtactaagatcactgacatgaagtttattaatgaagatgataacgcaatgctg
ttgacagggtcttctgatggtgtagtcagaatctacaaaaatttccaatctatggaggat
atcaggttggccactgcttggagggcattaaccgatcttctgcttacctctcgaaccaca
ggattggtttctgaatggcaacaatccactggatcattgttagtcagtggtgacgtcaag
attattaggatttgggatgctcctcgtgagctatgcgtggtcgacatccctgccaggtct
acgagttccataacctctctgacatccgaccaagttgctggaaatattttcgttggagga
tttggtgacggaactattcgtgtctacgatcgaagactggactctagagattcaatggtt
aagatttggcaaaacagggaatcaagaggaatgattaaaaacgttcatatgcaaagaggt
ggacatcgagagctcatgagtgcatccaataatatggtcaatctttgggacattcgacta
gataaaccaatcgagtcatttcctcatagatctatcactgcttccttaatccatgagcat
gctccagtgatcctgaccgcttccaagatagttaatgtcgctaccaccacaggtgaacat
gtttcaactatcagagatccctcgccatatttatccaataagactgctggctacgtttct
tccatgatgcttcatccgcatagaatgatggtggccacgtcacacacccaagactctcat
attcagttgtacaagtgcactgataaactagtgcaggaacacgatggttactag

DBGET integrated database retrieval system