KEGG   Komagataella pastoris: PAS_chr2-1_0533Help
Entry
PAS_chr2-1_0533   CDS       T01092                                 

Definition
Uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppa  Komagataella pastoris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAS_chr2-1_0533
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAS_chr2-1_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(990518..991315)
Genome map
AA seq 265 aa AA seqDB search
MPKAILLKNKTTPKDPYLENFVSSGYSTDFVPLLDHIHMEKSEIIAFLKTDYFLHKTLAF
IITSQRAVEMLNECMQILRRTDPEITQIIYSKPVYTVGPATYRILADAGFVDLRGGDKAG
NGSILAQIILNDDIYTGIEDSDKHITFFTGETRRDIIPKCLLSNNFQLYEKIVYKTLPRD
DIVTRFKSAVDSIDQSQRSSSWVVFFSPQGTEDIVTYLQHTKDQFNIASIGPTTEKYLLS
KNLKPKVVAPKPEPISLLLSIQKVH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagccattcttctgaagaataaaactacaccgaaggatccttatctggagaac
ttcgtaagtagtggctactcgaccgatttcgtaccacttttagatcatattcacatggag
aaatctgagatcatcgcatttctcaagactgactactttttgcataaaactttggcgttt
attattacgtcccaaagagctgtagaaatgctgaatgagtgtatgcaaatactgagacgt
actgatcctgaaattacacaaatcatctatagtaaacctgtctatacagttggccctgcc
acctacagaatacttgcggatgctggcttcgtggatctacgaggcggagataaggcagga
aacggatccattctagcccagataattttgaatgatgacatttacactggaattgaagat
tctgacaagcatataacgtttttcacgggagaaacaaggagagacataattcccaaatgt
ttactctctaacaactttcaactttacgaaaagattgtctacaagactcttcctagggat
gatatcgtgactagattcaagtctgccgttgacagcatcgaccaatcgcaaagaagttcc
agttgggtggtcttcttttcgcctcaaggaacagaggacattgtaacgtatcttcaacac
accaaagaccaatttaatattgcatctatcgggccaaccacagaaaaataccttctaagc
aaaaacctgaaaccaaaagttgtggcacctaagccagagcctatctctttactattgtct
atacaaaaagtgcactaa

DBGET integrated database retrieval system