KEGG   Pichia pastoris: PAS_chr2-1_0547Help
Entry
PAS_chr2-1_0547   CDS       T01092                                 

Definition
Bisphosphate-3'-nucleotidase, involved in salt tolerance and methionine biogenesis
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppa  Pichia pastoris
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAS_chr2-1_0547
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PAS_chr2-1_0547
Transfer RNA biogenesis [BR:ppa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PAS_chr2-1_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1014001..1015059)
Genome map
AA seq 352 aa AA seqDB search
MFSREVKLAQLAVKRASLLTKRISDEIAARTVGGISKSDDSPVTVGDFAAQSIIINSIKK
AFPNDEVVGEEDSAMLKKDPKLAEKVLEEIKWVQEQDKANNGSLSLLNSVDEVCDAIDGG
SSEGGRQGRIWALDPIDGTKGFLRGDQFAVCLALIVDGVVKVGVIGCPNLPFDLQNKSKG
KGGLFTAAEGVGSYYQNLFEEILPLESSKRITMNNSLSFDTCRVCEGVEKGHSSHGLQGL
IKEKLQIKSKSANLDSQAKYCALSRGDAEIYLRLPKDVNYREKIWDHAAGNILIKESGGI
VSDIYGNQLDFGNGRELNSQGIIAASKNLHSDIITAVKSIIGDRGQDLEKYI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcagggaagttaagctagcccaattggctgtcaaaagggcatctctattgact
aagaggataagtgatgagattgcagctcgcacagttggcggaatttcgaaatcggacgat
tctccagtcactgtgggggactttgctgctcagtctatcatcatcaacagcatcaagaaa
gccttccccaatgatgaggttgttggagaagaagactctgcgatgttgaagaaagaccca
aagctggctgaaaaggtgttggaagagatcaagtgggttcaagagcaggacaaagccaac
aatgggtcgttatctctgttgaactcggtagacgaagtttgcgatgctatcgacggcggc
agctctgaaggtggccgtcaaggaagaatttgggccttggatcccattgatggtactaag
ggcttcctgagaggcgaccaatttgccgtttgtctggcattaatcgtggatggggttgta
aaagttggtgtaattgggtgtccaaatctaccgtttgacctacaaaataagagcaaggga
aaaggaggacttttcaccgcagctgaaggcgtaggatcatactatcagaacttgtttgaa
gagatcttgcctctggaatcatcaaaaagaatcacaatgaacaattctctttcttttgat
acctgcagagtctgtgaaggtgttgagaagggtcattcaagtcatgggttgcaaggatta
ataaaagaaaagctccagatcaagtccaagtccgccaacttggattctcaagccaagtac
tgtgctctgtcgagaggagatgctgaaatatatttgaggttgccaaaagatgtgaattac
cgagagaaaatatgggatcatgctgctggcaacattctgatcaaggaaagcggaggcatt
gtgtctgatatttatggtaaccagttggattttggcaacggtcgggagctcaactcgcag
ggaataatcgcggcatcaaaaaatttacatagcgatatcatcactgcagtgaaaagtatt
attggagatagaggccaagatttggagaagtatatatag

DBGET integrated database retrieval system