KEGG   Pichia pastoris: PAS_chr2-1_0557Help
Entry
PAS_chr2-1_0557   CDS       T01092                                 

Definition
PIK-related protein kinase and rapamycin target
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ppa  Pichia pastoris
Brite
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PAS_chr2-1_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1028918..1036171
Genome map
AA seq 2417 aa AA seqDB search
MTQAELYTLDQVFNGLRSRNPQRRLLSARNLKEHLLSVSREFTPSEQVKRYNSDVYKRIS
DLIESKNNWEKLGGVEAINALLDLNADGNDDLVASSNSNTEDRKIKRTVLKTYLDKLIPS
SDLEVMYSATRTLGKLAIPGSALAGPLVEFYMPRAIEWLNPDNKQEYRHAAVLIITSLSY
NLSTSIYNYVHKILENIWIALRDSKLIIREDAAIAMRYCLSIVYERDSQMAQFWFSALYT
EASQCFKATPTSSTTISSTAVEVIHGSLLCYRELVIKGTSLLSDKIDELYDNLNKLKDHK
NVIIRREFSSIIPKLAHFNRANFVEKHLHRVLLYYFTQLKIPRDRDFIFVAIGDIATEVK
NRIVDYLEGILTNIDEALAVRSVKARREIEPACFYCLEKLALALGSCMTKYINNYHTLNR
IFKCSINDNMIQTLQVLIEKLPALEPAINERLIKIVTLCLSGYEYKHPGSQGYKRQMNTS
LAQEYRQQMLQRDGGTLIYEKAYTGYSTESGYEQNLRDLDEDPDVTVIIQALKVLSCFHF
ADYNLTDFTRFSVMTYVDHDNIEVRKRAALTTCALFMKDSICYQTSESSLKAVNEVLGKL
LVICITDPVAEIRLEVLKVLGENFDPQLSQADNAKLLFVATNDGNFEIRKAAIKIIGRLS
AINPAYIVPSLRKLLMQLLTTLEYDGSSKRREETAAILSTLISHSKDVTKPYVKQILDVL
IPKAKDQSSGASINAIQAIGELAVVSGEDMKPFIHEMMPIFLDTFQDQSAGYKRDTALRA
LGQLASSSGYVIDPLLDYPQLLGMLVSILKSESSQMVRRETVRLLGVLGALDPYKHREVD
WKIKSSLPMEQITEQNAPPIDVSLLMQGMSPSNEEFYPTVVITTLMKILKDSSLVNHHTA
VAQAVIYIYQTLNTKCIPFLNHVIPGFIHVMMNYPDVRLEFYFNQLGKLINIVKQHVRPY
LKDIFVLIKKYFATPNLTVTILGLIQIISSAMDGEFKLYLTEILPLMLEVLETDTSPERE
ASLAVLNTFVVLGSNIDLYVHLVIPQIVSLFDFSPYRLRKASIETIGKLASTVHLNDLSS
RIIHPLLRALETNSSDELKKTIMNTISIMLLQMRENFLVFIPLINKILVQHKWKFPVYEQ
LMEKLLNGQKLPQNLIIGPEHESLRTEAMEIEPSSNKLTLNQQALRQSWDASQCRTKVDW
VEWIMRLSLELLRESPSHALRACSTLASDYTPLAKDLFNVSFASCWNELSPQNKNDLIQA
FGIALSAVQNPPEIHQQLLNVVEFMERDDKPLPIRVPTLGQYAKRCHAYAKALHYKELEF
IQEPSTPTIESLISINNQLQQSDAAIGILKQAQQHHDLQLKETWYEKLQRWDDALNAYNE
REKEDPDSMDITMGKMRSLHALGEWEQLSELAQDKWLNSSTEIRRAIAPLAAAASWGLGQ
WDRMDTYIGIMKHESPDKAFFNAVLCLHRNNFEGASTQILRARDLLITEMTALVSESYNR
AYSVVVRVQMLAELEEIIRYKCYPQGSEKRAMMRQTWTKRLLGCQRNVDIWQRMLKVRAL
VVKPKQDMEMWIKFANLCRKSGRLGLAEKSLNSLLDEGDSDNPRPSRAPPQVVYAQLKYM
WASGQQRAALSHLIDFTSKLSRDLGLNENEAITQPLPTEVPGAAKHVEEYTKLLARCYLK
QGEWKVTLNPNWRNEEATGSILGSYLLATHFDSNWYKAWHNWALANFQVISAHQSTHDGI
ADVSSSARSSHTPDEVKPDMLQHYVIPAIKGFFHSISLSELNPLQDTLRLLTLWFSFGGI
TEAAHAMLEGFSMVKIDTWLQVIPQLISRIHQPNEVMSRSLLNLLTDLGKAHPQALVYPL
AVAVKSNSELRKQAALTIIEKMRIHSPTLVEQSELVSEELIRVAVLWYELWYEGLEDASR
LFFGEHNTEKMFLVLEPLHKLLDKGPETLREISFQNAFGRELNDAFNWVLNYRNTKDIAN
LNQAWDIYYNVFRRINRQLPQLKTLELQYVSPKLLAAHDLELAVPGTYSAGQPIICIQSF
DSTFSVINSKQRPRKMNIRGSDGKGYQYVLKGHEDIRQDSLVMQLFGLVNTLLVNDAECF
KRHLDIQQYPAIPLSPSSGLLGWVPNSDTFHVLIRDYREPRKILLNIEHRIMLQMAPDYE
NLTLLQKVEVFTYALDNTRGQDLYKVLWLKSRSSEAWLDRRTTYTRSLAVMSMVGYILGL
GDRHPSNLMMDRITGKVIHIDFGDCFEAAILREKFPEKVPFRLTRMISYAMEVSGIEGSF
RITCENVMRVLRENKESLMAILEAFAYDPLINWGFDFPIDELAESSGLKLNAISPSELLA
RGEVSEKEASEIESEYNQQMRNARAAFVLKRITDKLTGNDFKRAHELDVTNQVDKLIQQA
TSVENLCQHYIGWCSFW
NT seq 7254 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcagagttgtacacattggaccaagtatttaatggtcttcgatcccgcaat
cctcagcggcgattgctctctgcgaggaatctgaaggaacaccttctttccgtttctcga
gagtttactcctagtgagcaggttaagaggtataactcagacgtctacaagcgtatcagt
gatctgatagaaagcaagaataactgggaaaaattaggaggcgttgaagctatcaatgca
ttacttgatctcaatgctgatggcaatgacgatttggtggcttcttctaattctaacaca
gaagaccgaaaaattaagaggacggttctgaaaacgtatttggacaaattgattccatcc
tctgatttagaagtgatgtatagtgctaccaggacgttggggaaacttgctatcccaggc
agtgcattggctggaccactggtagaattttacatgccacgggctattgaatggctcaac
cctgataacaaacaagaatatagacacgcagcagtgttgatcatcacttctttatcttat
aacttgtccacctcaatctataattacgttcacaagattttggagaacatatggatcgca
ttaagagattccaagctgataataagagaagatgctgccatcgcaatgagatactgtctc
tcgattgtatacgaaagggatagtcaaatggctcaattttggtttagtgctctttacact
gaagccagtcaatgttttaaggcaacgccaactagtagcaccaccattagtagcacggct
gttgaagttatccatggttcattgctttgctatcgggaattggttatcaaaggtactagt
ctgctgtcagacaaaattgatgaactatatgataacctaaacaaacttaaagaccacaag
aatgtaattataagaagagagttctccagtataattccaaaacttgcgcattttaatcgt
gcaaattttgtggagaaacatcttcacagagtgttactgtactacttcactcagctcaaa
ataccacgagacagagatttcatttttgtagcaatcggtgacattgcaaccgaagtcaaa
aaccgtattgttgactatctggagggtatattgactaatattgacgaagctttggctgta
agatctgtcaaagcgagacgtgaaattgaaccagcttgtttctattgcttggaaaaactt
gccttggctttaggctcctgcatgacaaagtatatcaataattatcacactctgaatcgc
attttcaaatgctctatcaacgacaacatgattcaaactttacaagtcctgatagaaaaa
ctgccagcactagagcctgctataaacgagcgcttgattaagatagtgacgctttgtttg
agcggttatgaatataagcatcctggatctcagggctataaaagacaaatgaatacgtct
ttagcgcaagaatatagacaacagatgttacaacgagatggtggcactttaatttatgag
aaagcatatactggatactctactgaaagcggctatgaacagaatcttcgagaccttgac
gaggatccagatgtaacagttatcatacaagcattgaaagtgctcagctgctttcacttt
gccgactataatctcacagattttacccgcttttcagtcatgacttatgtcgatcatgac
aatattgaagtgagaaaaagagccgccctaacgacatgtgctttgttcatgaaggattct
atttgctatcaaactagtgaaagttctttgaaggctgtcaatgaggttttggggaaacta
ctagtcatttgcattacggatcctgttgcggaaataaggctggaagttctaaaggtactc
ggagaaaactttgaccctcaactttcccaggctgataacgcaaaactattgtttgtggca
acaaacgatggcaacttcgagatcaggaaggcagcaattaaaataataggtcggttatct
gctataaatcctgcttacattgttccgtcattaagaaaacttttgatgcaactgttgaca
actttagagtatgacgggagttccaaaagaagggaggaaacggctgctattttgtctaca
ctgatttctcactccaaggacgtgactaagccatacgtgaagcaaattttagatgtgttg
atcccaaaggcgaaagaccaatcatcaggcgcatcaataaatgcgattcaagctattggt
gagttggctgtagtgtctggagaagacatgaagccttttatccacgaaatgatgccgata
ttcttggatacatttcaggatcagagtgctggttacaagagagataccgcacttcgtgcc
cttggtcagttggctagttcttcgggttatgtaattgatccactattagattaccctcag
ctactcggaatgttggtgagcattttaaaatcagaaagctcacagatggtacgaagagaa
acagttaggcttctaggagttctaggagcactggacccatacaagcacagggaagttgat
tggaagattaagagttcattgcctatggagcaaatcacagaacaaaatgctccgccaata
gacgtctcgctgctaatgcaaggcatgtccccttctaatgaggagttctaccctactgtt
gtaataactactttgatgaagatattaaaagatagttctctagtcaatcatcacacggca
gtggctcaagcggtgatctacatctaccaaacgttgaatacgaaatgtattccttttcta
aaccatgtcattccaggctttattcacgtaatgatgaattatccagatgtaagactagaa
ttttacttcaatcaacttgggaagcttatcaacattgtcaagcaacatgtcagaccgtat
ctgaaggacatttttgttttaattaaaaagtattttgctactccaaatttgacagtgacc
atattagggttaatccaaattatctcttctgctatggacggagagttcaaactatattta
acggagattcttcctttgatgctggaagttttggaaacggatacttcgcctgagagagaa
gcttctctagctgtgttgaacactttcgtggttcttggatccaatatagatctatacgta
catcttgtcattccacagatcgtttcattgtttgacttctctccttatagactgcgaaaa
gcttccatcgagactattggaaagctagcaagtactgttcatctcaatgatttatcttca
agaattatccatcctctgttaagagcattagaaacaaattcaagcgatgaactaaaaaag
acaattatgaatacgatttccattatgctacttcaaatgagagaaaactttttagtattc
attccattgattaataagatcttagttcaacataaatggaagttccctgtttatgagcaa
ttaatggaaaaactcttgaatggccaaaaactaccccagaacttgataataggacctgag
catgaatctcttagaactgaagcaatggaaatcgaaccttcctccaacaagctgacatta
aatcaacaagctttgcgacaatcttgggatgcaagtcaatgtaggactaaagtggattgg
gttgagtggattatgcgtctaagtttggagcttttgagagagtcaccatctcacgcactt
cgggcttgttcaaccctggctagtgattatactccactcgctaaagatctcttcaatgtc
agttttgccagttgttggaacgagttgtcacctcaaaacaaaaatgacttgattcaggct
tttggaattgctctatctgcggtgcagaatcctcctgagattcatcagcagctactgaac
gtagtcgaattcatggaacgtgatgataagcctttaccaatcagggtcccaactcttggg
caatatgccaagagatgtcatgcttacgcaaaagctttgcattacaaagagttggagttt
attcaagaaccctccacccctactattgaatctttgatcagtataaacaaccagttacaa
cagtctgatgctgctatcggtattctgaagcaagcacaacagcaccatgatttacaattg
aaagaaacatggtatgaaaagcttcaaagatgggacgatgcattaaacgcttataatgaa
agagaaaaggaagatcccgactctatggacataacaatgggtaaaatgagatctttacat
gctttgggtgaatgggagcagttgtctgagctagcgcaggacaaatggctaaattcatct
actgaaatccgaagagctattgcaccgctagccgcagcagcttcttggggtcttggtcaa
tgggaccgaatggacacgtatattggtatcatgaagcatgagtctccagataaagcattc
ttcaatgcagttttatgtcttcatcgaaacaactttgagggcgcttcaacccaaatacta
agagccagagacttgttgataactgaaatgacagctctggtaagtgaatcttacaataga
gcttatagtgtcgttgttcgtgttcaaatgttggctgaactggaagaaattattaggtac
aagtgttatccacaaggttcagaaaagagggctatgatgaggcagacttggaccaaacga
ttacttggatgtcaaaggaatgttgatatatggcagcgaatgcttaaagttcgtgcattg
gttgtaaagcccaaacaagacatggaaatgtggatcaaatttgcaaacttgtgccgaaag
agtggaaggctgggtttagcagaaaaatcattaaattctttgttagatgaaggagactct
gataacccaaggccatctcgtgcccctccacaagtagtctatgcccagttgaagtatatg
tgggcttcaggtcaacagagagctgcactgagtcatttgatagacttcacgtctaaactc
tcaagagacctgggtttgaacgagaatgaagcaattactcaacctttgccgacagaagtt
cctggtgctgcaaaacatgttgaagaatacaccaagcttttagcaagatgctacttgaag
caaggtgaatggaaggttacactcaatcctaattggagaaacgaggaggcaactggaagt
attcttggatcgtaccttttggcgactcactttgatagtaattggtacaaggcgtggcat
aattgggctttggccaactttcaagttatctccgctcatcagtccactcatgatggtata
gctgatgtatctagtagtgctagatcaagtcatacaccggatgaagttaagccagatatg
ctacagcattatgttattcctgcaatcaagggattcttccattctatctctctatctgaa
ctaaatccgctacaagacactttacgtcttttgacgctgtggtttagctttggaggtatt
actgaagctgctcacgctatgctggaaggattctcaatggttaaaattgacacttggctt
caggttattcctcagctgatatctcgtatccatcagcccaatgaagttatgagccgatct
ttactgaacttactgactgatctcggaaaggcacaccctcaggctttggtataccccttg
gcagttgctgtaaagtctaacagtgagttgaggaaacaggctgcattaaccattattgaa
aagatgcgtattcacagtccaacgttggttgagcaatctgaattggtcagtgaagagttg
atcagagttgcagtgctatggtatgaactttggtacgaaggtcttgaggatgcttcaaga
ttattctttggagaacataatactgagaagatgtttttagtattggaaccgttgcacaaa
ttgctagacaagggtcctgagacattgcgtgagatttcgttccaaaatgcttttggccgt
gaattgaacgatgcattcaactgggtgctcaattaccgaaatacgaaagatattgccaac
ttgaatcaagcttgggatatctactacaatgttttccgccgtatcaacagacaacttcct
caattgaagactttagaacttcaatacgtgtcgccaaaattacttgctgcgcatgactta
gagctagcggtaccaggtacttactcagctggccaacctatcatctgtattcaaagcttt
gattctacatttagcgtgattaactcaaaacaaagaccaagaaaaatgaacattagagga
agtgatggtaagggataccagtatgtgctaaagggccatgaagacataaggcaagacagt
ttagttatgcagctgtttggattggtaaatacattattagtcaatgacgctgaatgtttc
aagaggcatttagacattcaacaatacccagcaattccattgtcaccaagttcagggctc
ttaggatgggtacccaattccgatactttccatgtgctaatccgtgattaccgtgaacca
agaaagatcttactgaatattgaacatcgtatcatgttacaaatggccccagattacgag
aaccttaccttgcttcaaaaggtagaagtatttacttatgcattagacaacaccaggggt
caggacttatacaaagttctttggctgaaaagtcgttcgtcagaggcatggttggacaga
aggaccacttataccagatctttggccgtaatgtctatggttggttatatactcggtttg
ggtgacaggcatccaagcaatttgatgatggaccgtatcactggtaaggtgatccatatc
gattttggagattgttttgaagctgcaattttgagagagaaattccctgagaaggtgcct
ttcaggttgacaagaatgattagttatgctatggaagtaagtggtatcgaaggaagtttc
cgcatcacttgtgaaaacgtcatgagggtattgcgtgaaaacaaagagtcgttaatggcc
atcttggaggcatttgcatatgatccgttgatcaactggggatttgatttcccgatagac
gaactagccgaatctagtggactcaaattgaacgccatatcgccatctgagcttctagcc
agaggagaagtgtcagaaaaagaagcttcagaaatcgagtctgaatacaaccagcagatg
agaaacgctagagctgcatttgtcctgaagagaatcaccgacaaactaacaggaaatgat
ttcaagagagcccatgaattagatgttaccaaccaggttgataagctgatccaacaggca
acatctgtggaaaatctatgccaacattatatcggttggtgttctttctggtaa

DBGET integrated database retrieval system