KEGG   Komagataella phaffii: PAS_chr2-1_0595Help
Entry
PAS_chr2-1_0595   CDS       T01092                                 

Definition
(RefSeq) Calcineurin B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ppa  Komagataella phaffii
Brite
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PAS_chr2-1_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 Sigma54_CBD
Motif
Other DBs
NCBI-GeneID: 8198032
NCBI-ProteinID: XP_002491512
UniProt: C4R158
Position
2:join(1107991..1108042,1108100..1108575)
Genome map
AA seq 175 aa AA seqDB search
MGLASSKIMDSLAEGTNFDREEVDRLRKRFMKLDTDGSGTIDKKEFLSIPGVNTNPLAER
LLDLFDEDGGGDIDFQEFIIGLSTFSSRSSITDKLSFAFKIYDIDRDGFISNGELFIILK
TMVGGNLKDEELQQIVDRTLMENDLDGDGKLSFDEFKSAVDHTSIVNKFTLNLGI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggctagcttcttccaagattatggactcccttgcggagggaaccaactttgatagg
gaagaagtcgacagacttagaaagagattcatgaaattggacactgatggttcgggtacc
attgacaagaaagagttcctttcgattccaggtgtaaatacgaacccacttgcagaacgc
ttgctagatttgtttgacgaagatggcggtggagatattgattttcaagagtttatcatt
ggtctttcgacgtttagtagccgaagtagcatcactgacaaattaagttttgctttcaag
atctatgacatagacagagatggttttatttccaatggagaattatttattatattaaag
actatggttggtgggaatctgaaggacgaagagctacaacaaatagtggaccggacattg
atggaaaacgacctcgatggcgacggaaagttgagttttgatgaattcaagagtgcagtc
gatcatacaagcattgtgaacaagttcacgctgaatttgggaatatga

DBGET integrated database retrieval system