KEGG   Pichia pastoris: PAS_chr2-1_0595Help
Entry
PAS_chr2-1_0595   CDS       T01092                                 

Definition
Calcineurin B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ppa  Pichia pastoris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(1107991..1108042,1108100..1108575)
Genome map
AA seq 175 aa AA seqDB search
MGLASSKIMDSLAEGTNFDREEVDRLRKRFMKLDTDGSGTIDKKEFLSIPGVNTNPLAER
LLDLFDEDGGGDIDFQEFIIGLSTFSSRSSITDKLSFAFKIYDIDRDGFISNGELFIILK
TMVGGNLKDEELQQIVDRTLMENDLDGDGKLSFDEFKSAVDHTSIVNKFTLNLGI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggctagcttcttccaagattatggactcccttgcggagggaaccaactttgatagg
gaagaagtcgacagacttagaaagagattcatgaaattggacactgatggttcgggtacc
attgacaagaaagagttcctttcgattccaggtgtaaatacgaacccacttgcagaacgc
ttgctagatttgtttgacgaagatggcggtggagatattgattttcaagagtttatcatt
ggtctttcgacgtttagtagccgaagtagcatcactgacaaattaagttttgctttcaag
atctatgacatagacagagatggttttatttccaatggagaattatttattatattaaag
actatggttggtgggaatctgaaggacgaagagctacaacaaatagtggaccggacattg
atggaaaacgacctcgatggcgacggaaagttgagttttgatgaattcaagagtgcagtc
gatcatacaagcattgtgaacaagttcacgctgaatttgggaatatga

DBGET integrated database retrieval system