KEGG   Pichia pastoris: PAS_chr2-1_0635Help
Entry
PAS_chr2-1_0635   CDS       T01092                                 

Definition
Catalytic subunit of type 1 serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ppa  Pichia pastoris
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PAS_chr2-1_0635
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PAS_chr2-1_0635
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PAS_chr2-1_0635
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PAS_chr2-1_0635
Transcription machinery [BR:ppa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PAS_chr2-1_0635
Spliceosome [BR:ppa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PAS_chr2-1_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1196250..1197212)
Genome map
AA seq 320 aa AA seqDB search
MADQQSFDLDSVIDRLLEVRGSKPGKLVELEEFEVKYLCTKAREIFIQQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGRQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYSIKLWKAFTDCFNCLPIAAIIDEKIFAMHGGLSPDL
GNMDQIRRIMRPTDIPDVGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLHRHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKPQYSAYGVDNRKKKGSKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcaacaatcattcgacctcgactctgttattgacaggctcttagaagttagg
ggttcgaaaccgggcaagctagtagaactggaagagttcgaagtaaaatatctgtgtacc
aaggcaagagaaatattcatccaacaacccattctgctggaattggaagccccaatcaag
atctgtggagatatccatggacagtattacgacttgctacggctgtttgaatacggaggg
ttccctccggaggcaaactacctgtttttgggtgactacgtggacagaggtagacaatcg
ttagagactatttgtctgttactagcgtacaaaataaagtacccagaaaactttttcatc
ttgaggggaaatcatgagtgtgcttcgatcaatagaatatacggcttctacgatgaatgt
aagagacgttatagtattaaattgtggaaggcattcacagactgttttaactgtttgcca
attgcggcaattatcgacgagaagatctttgcaatgcatggaggtttaagcccagactta
ggaaatatggaccagattagaagaattatgaggccaaccgacattccggacgttggtctt
ttatgtgacctgttatggtcagacccagacaaggatatcacgggatggagtgaaaatgat
agaggagtctcttttacatttggaccagatgtcgtgtcccgattcctacacagacatgac
atggacttaatttgtagggctcatcaagtggtcgaagatgggtacgaattcttttccaag
agacaattggtgactctgttttcggcccccaactactgcggtgagtttgataatgcaggc
gccatgatgagtgttgacgaaagtttgctgtgctccttccagatcctcaagcctgccgag
aagaaaccacaatatagtgcttatggggtggataatagaaagaagaaaggttcaaagtat
tag

DBGET integrated database retrieval system