KEGG   Komagataella pastoris: PAS_chr2-1_0679Help
Entry
PAS_chr2-1_0679   CDS       T01092                                 

Definition
Tryptophan synthase involved in tryptophan biosynthesis
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ppa  Komagataella pastoris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAS_chr2-1_0679
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr2-1_0679
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAS_chr2-1_0679
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAS_chr2-1_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(1293942..1296013,1296066..1296111))
Genome map
AA seq 705 aa AA seqDB search
MTTNLKRAFEKAKKQNRSALITFVTAGYPTINDTVPILQGLQAGGVDIIELGIPFSDPIA
DGPTIQAANTKALENGVNIDICLDIVKQARAKGVSVPIVLMGYYNPILAYGEQKMIEATK
IAGANGYIICDLPPEEAVKFRGYCAKQGLSYIPLVAPATTDERLDVLSKISDSFIYVVSR
MGTTGAQTKMSDTLPQLVKRVKSFAGSSPIAVGFGVSTREHYLDVGASSDGVVIGSKLIN
VIDAAPESLRADAAKKFVREILGRTDDTTITDSLSDNDNEIPYQEIATEETQFNEVHKCN
PHFGQFGGQYVPEALHTCLAELEKGFDAAVADPEFWKEFKSLYPYIGRPSSLHRAERLTE
YAGGAQIWLKREDLNHTGSHKINNALAQVILARRLGKNRVIAETGAGQHGVATATAAAKF
GMKCTVFMGAEDVRRQALNVFRMRILGASVVAVQEGTRTLRDATSEAFRFWVSNLETTHY
VVGSAIGPHPYPTLVRTFQSIIGSETKEQFKELNDGKLPDAVCACVGGGSNSTGMFSPFE
KDESVKLYGFEAGGDGIDTPYHSATLTAGKPGVFHGVMTYVLQDNDGQIHDTHSVSAGLD
YPGVGPELAAWKANGRAQFSAVTDAQALEGFKILSQLEGIIPALESSHAIYGALQIAKTM
SSDQSLVINVSGRGDKDVQSVAEILPKLGPQIGWDLRFSEDITKE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaatttgaaacgtgcctttgaaaaggctaaaaagcaaaaccgtagtgcttta
atcacgttcgtcactgctggttaccctactattaacgacactgtccccattttgcaagga
ctgcaagctggtggcgtggatattattgagctgggaattcccttcagtgacccaattgct
gacggtcctaccattcaagctgccaacaccaaagcattggagaatggtgttaatatagat
atctgtttggacattgttaaacaagccagagctaaaggtgttagcgttcctatcgtctta
atgggctactacaatccaattttggcttatggagaacaaaaaatgattgaggccaccaaa
atagcaggtgcaaacggttacatcatttgcgacctgcctcctgaagaagctgttaaattt
agaggttattgcgctaagcaaggtctaagttatattcctttggttgctcccgctaccacc
gatgagagattggatgttctgagcaagatctcagattcattcatctatgtcgtttctaga
atgggaaccacaggtgcacaaacaaaaatgtctgacacattgcctcaattggtgaagaga
gtaaaaagctttgcggggtcaagcccaattgctgtaggatttggtgtcagtactcgcgag
cattatttggatgttggggcttcttctgatggtgttgtcatcggaagtaagttaatcaac
gttattgacgcagcacctgaaagcttaagagctgatgctgcaaagaagttcgtcagagaa
attcttggacgtacagatgatactactattactgattctttgagtgacaatgacaacgag
attccatatcaagaaattgcaactgaggaaactcagttcaacgaggttcacaaatgtaac
cctcattttggacaatttggtggtcagtatgtacctgaagctttgcacacttgtttagca
gaactagagaaaggctttgatgccgcggtggctgatccagaattttggaaagagtttaaa
tctctttacccctatattggaagaccatcttcccttcaccgcgctgaaagactaactgag
tacgctggtggagcccaaatctggttgaagagagaagacttgaatcatacagggtctcat
aaaatcaacaatgctttggctcaagtaattcttgctcgtcgtctaggcaagaatcgtgtt
attgctgagactggtgctggtcaacatggtgttgcaactgctactgctgctgccaaattt
ggtatgaaatgcactgtttttatgggagcagaagacgttcgccgtcaagccctcaatgtt
ttcaggatgagaatcctaggtgcatctgttgtggctgtccaggaaggaacaaggactctt
cgggatgccacttctgaagccttcagattctgggtgtcaaatcttgaaaccactcactac
gttgtaggatccgctattggacctcatccatacccaacattagtgagaacttttcaaagt
attattggaagcgaaactaaagaacagttcaaggaactgaacgatgggaagcttcctgat
gccgtttgtgcttgtgttggtggagggtccaactctacaggtatgttctcaccatttgaa
aaagacgaatctgtaaagctttatggatttgaagccggtggagatggtattgatacacct
taccattcggctactttgactgcaggtaagccaggtgtgtttcatggagttatgacttat
gtactacaagataacgacggccaaattcatgatacacactctgtttcagctggtttggac
taccctggagttggtcctgaattggctgcctggaaagcaaatggtagagcccaattttcc
gctgtaactgatgcccaagcattagagggattcaaaatcctgtctcaattggaagggatc
attccagcactagagtctagtcatgcaatctacggcgcattgcaaattgcaaagactatg
tcttcggaccagtccttagttattaatgtatctggaaggggtgataaggacgtccagagt
gtagctgagattttacctaaattgggacctcaaattggatgggatttgcgtttcagcgaa
gacattactaaagagtga

DBGET integrated database retrieval system