KEGG   Pichia pastoris: PAS_chr2-1_0679Help
Entry
PAS_chr2-1_0679   CDS       T01092                                 

Definition
Tryptophan synthase involved in tryptophan biosynthesis
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ppa  Pichia pastoris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(1293942..1296013,1296066..1296111))
Genome map
AA seq 705 aa AA seqDB search
MTTNLKRAFEKAKKQNRSALITFVTAGYPTINDTVPILQGLQAGGVDIIELGIPFSDPIA
DGPTIQAANTKALENGVNIDICLDIVKQARAKGVSVPIVLMGYYNPILAYGEQKMIEATK
IAGANGYIICDLPPEEAVKFRGYCAKQGLSYIPLVAPATTDERLDVLSKISDSFIYVVSR
MGTTGAQTKMSDTLPQLVKRVKSFAGSSPIAVGFGVSTREHYLDVGASSDGVVIGSKLIN
VIDAAPESLRADAAKKFVREILGRTDDTTITDSLSDNDNEIPYQEIATEETQFNEVHKCN
PHFGQFGGQYVPEALHTCLAELEKGFDAAVADPEFWKEFKSLYPYIGRPSSLHRAERLTE
YAGGAQIWLKREDLNHTGSHKINNALAQVILARRLGKNRVIAETGAGQHGVATATAAAKF
GMKCTVFMGAEDVRRQALNVFRMRILGASVVAVQEGTRTLRDATSEAFRFWVSNLETTHY
VVGSAIGPHPYPTLVRTFQSIIGSETKEQFKELNDGKLPDAVCACVGGGSNSTGMFSPFE
KDESVKLYGFEAGGDGIDTPYHSATLTAGKPGVFHGVMTYVLQDNDGQIHDTHSVSAGLD
YPGVGPELAAWKANGRAQFSAVTDAQALEGFKILSQLEGIIPALESSHAIYGALQIAKTM
SSDQSLVINVSGRGDKDVQSVAEILPKLGPQIGWDLRFSEDITKE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaatttgaaacgtgcctttgaaaaggctaaaaagcaaaaccgtagtgcttta
atcacgttcgtcactgctggttaccctactattaacgacactgtccccattttgcaagga
ctgcaagctggtggcgtggatattattgagctgggaattcccttcagtgacccaattgct
gacggtcctaccattcaagctgccaacaccaaagcattggagaatggtgttaatatagat
atctgtttggacattgttaaacaagccagagctaaaggtgttagcgttcctatcgtctta
atgggctactacaatccaattttggcttatggagaacaaaaaatgattgaggccaccaaa
atagcaggtgcaaacggttacatcatttgcgacctgcctcctgaagaagctgttaaattt
agaggttattgcgctaagcaaggtctaagttatattcctttggttgctcccgctaccacc
gatgagagattggatgttctgagcaagatctcagattcattcatctatgtcgtttctaga
atgggaaccacaggtgcacaaacaaaaatgtctgacacattgcctcaattggtgaagaga
gtaaaaagctttgcggggtcaagcccaattgctgtaggatttggtgtcagtactcgcgag
cattatttggatgttggggcttcttctgatggtgttgtcatcggaagtaagttaatcaac
gttattgacgcagcacctgaaagcttaagagctgatgctgcaaagaagttcgtcagagaa
attcttggacgtacagatgatactactattactgattctttgagtgacaatgacaacgag
attccatatcaagaaattgcaactgaggaaactcagttcaacgaggttcacaaatgtaac
cctcattttggacaatttggtggtcagtatgtacctgaagctttgcacacttgtttagca
gaactagagaaaggctttgatgccgcggtggctgatccagaattttggaaagagtttaaa
tctctttacccctatattggaagaccatcttcccttcaccgcgctgaaagactaactgag
tacgctggtggagcccaaatctggttgaagagagaagacttgaatcatacagggtctcat
aaaatcaacaatgctttggctcaagtaattcttgctcgtcgtctaggcaagaatcgtgtt
attgctgagactggtgctggtcaacatggtgttgcaactgctactgctgctgccaaattt
ggtatgaaatgcactgtttttatgggagcagaagacgttcgccgtcaagccctcaatgtt
ttcaggatgagaatcctaggtgcatctgttgtggctgtccaggaaggaacaaggactctt
cgggatgccacttctgaagccttcagattctgggtgtcaaatcttgaaaccactcactac
gttgtaggatccgctattggacctcatccatacccaacattagtgagaacttttcaaagt
attattggaagcgaaactaaagaacagttcaaggaactgaacgatgggaagcttcctgat
gccgtttgtgcttgtgttggtggagggtccaactctacaggtatgttctcaccatttgaa
aaagacgaatctgtaaagctttatggatttgaagccggtggagatggtattgatacacct
taccattcggctactttgactgcaggtaagccaggtgtgtttcatggagttatgacttat
gtactacaagataacgacggccaaattcatgatacacactctgtttcagctggtttggac
taccctggagttggtcctgaattggctgcctggaaagcaaatggtagagcccaattttcc
gctgtaactgatgcccaagcattagagggattcaaaatcctgtctcaattggaagggatc
attccagcactagagtctagtcatgcaatctacggcgcattgcaaattgcaaagactatg
tcttcggaccagtccttagttattaatgtatctggaaggggtgataaggacgtccagagt
gtagctgagattttacctaaattgggacctcaaattggatgggatttgcgtttcagcgaa
gacattactaaagagtga

DBGET integrated database retrieval system