KEGG   Komagataella phaffii: PAS_chr2-1_0679Help
Entry
PAS_chr2-1_0679   CDS       T01092                                 

Definition
(RefSeq) Tryptophan synthase involved in tryptophan biosynthesis
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ppa  Komagataella phaffii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAS_chr2-1_0679
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAS_chr2-1_0679
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAS_chr2-1_0679
Enzymes [BR:ppa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAS_chr2-1_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(1293942..1296013,1296066..1296111))
Genome map
AA seq 705 aa AA seqDB search
MTTNLKRAFEKAKKQNRSALITFVTAGYPTINDTVPILQGLQAGGVDIIELGIPFSDPIA
DGPTIQAANTKALENGVNIDICLDIVKQARAKGVSVPIVLMGYYNPILAYGEQKMIEATK
IAGANGYIICDLPPEEAVKFRGYCAKQGLSYIPLVAPATTDERLDVLSKISDSFIYVVSR
MGTTGAQTKMSDTLPQLVKRVKSFAGSSPIAVGFGVSTREHYLDVGASSDGVVIGSKLIN
VIDAAPESLRADAAKKFVREILGRTDDTTITDSLSDNDNEIPYQEIATEETQFNEVHKCN
PHFGQFGGQYVPEALHTCLAELEKGFDAAVADPEFWKEFKSLYPYIGRPSSLHRAERLTE
YAGGAQIWLKREDLNHTGSHKINNALAQVILARRLGKNRVIAETGAGQHGVATATAAAKF
GMKCTVFMGAEDVRRQALNVFRMRILGASVVAVQEGTRTLRDATSEAFRFWVSNLETTHY
VVGSAIGPHPYPTLVRTFQSIIGSETKEQFKELNDGKLPDAVCACVGGGSNSTGMFSPFE
KDESVKLYGFEAGGDGIDTPYHSATLTAGKPGVFHGVMTYVLQDNDGQIHDTHSVSAGLD
YPGVGPELAAWKANGRAQFSAVTDAQALEGFKILSQLEGIIPALESSHAIYGALQIAKTM
SSDQSLVINVSGRGDKDVQSVAEILPKLGPQIGWDLRFSEDITKE
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaatttgaaacgtgcctttgaaaaggctaaaaagcaaaaccgtagtgcttta
atcacgttcgtcactgctggttaccctactattaacgacactgtccccattttgcaagga
ctgcaagctggtggcgtggatattattgagctgggaattcccttcagtgacccaattgct
gacggtcctaccattcaagctgccaacaccaaagcattggagaatggtgttaatatagat
atctgtttggacattgttaaacaagccagagctaaaggtgttagcgttcctatcgtctta
atgggctactacaatccaattttggcttatggagaacaaaaaatgattgaggccaccaaa
atagcaggtgcaaacggttacatcatttgcgacctgcctcctgaagaagctgttaaattt
agaggttattgcgctaagcaaggtctaagttatattcctttggttgctcccgctaccacc
gatgagagattggatgttctgagcaagatctcagattcattcatctatgtcgtttctaga
atgggaaccacaggtgcacaaacaaaaatgtctgacacattgcctcaattggtgaagaga
gtaaaaagctttgcggggtcaagcccaattgctgtaggatttggtgtcagtactcgcgag
cattatttggatgttggggcttcttctgatggtgttgtcatcggaagtaagttaatcaac
gttattgacgcagcacctgaaagcttaagagctgatgctgcaaagaagttcgtcagagaa
attcttggacgtacagatgatactactattactgattctttgagtgacaatgacaacgag
attccatatcaagaaattgcaactgaggaaactcagttcaacgaggttcacaaatgtaac
cctcattttggacaatttggtggtcagtatgtacctgaagctttgcacacttgtttagca
gaactagagaaaggctttgatgccgcggtggctgatccagaattttggaaagagtttaaa
tctctttacccctatattggaagaccatcttcccttcaccgcgctgaaagactaactgag
tacgctggtggagcccaaatctggttgaagagagaagacttgaatcatacagggtctcat
aaaatcaacaatgctttggctcaagtaattcttgctcgtcgtctaggcaagaatcgtgtt
attgctgagactggtgctggtcaacatggtgttgcaactgctactgctgctgccaaattt
ggtatgaaatgcactgtttttatgggagcagaagacgttcgccgtcaagccctcaatgtt
ttcaggatgagaatcctaggtgcatctgttgtggctgtccaggaaggaacaaggactctt
cgggatgccacttctgaagccttcagattctgggtgtcaaatcttgaaaccactcactac
gttgtaggatccgctattggacctcatccatacccaacattagtgagaacttttcaaagt
attattggaagcgaaactaaagaacagttcaaggaactgaacgatgggaagcttcctgat
gccgtttgtgcttgtgttggtggagggtccaactctacaggtatgttctcaccatttgaa
aaagacgaatctgtaaagctttatggatttgaagccggtggagatggtattgatacacct
taccattcggctactttgactgcaggtaagccaggtgtgtttcatggagttatgacttat
gtactacaagataacgacggccaaattcatgatacacactctgtttcagctggtttggac
taccctggagttggtcctgaattggctgcctggaaagcaaatggtagagcccaattttcc
gctgtaactgatgcccaagcattagagggattcaaaatcctgtctcaattggaagggatc
attccagcactagagtctagtcatgcaatctacggcgcattgcaaattgcaaagactatg
tcttcggaccagtccttagttattaatgtatctggaaggggtgataaggacgtccagagt
gtagctgagattttacctaaattgggacctcaaattggatgggatttgcgtttcagcgaa
gacattactaaagagtga

DBGET integrated database retrieval system