KEGG   Komagataella phaffii: PAS_chr2-1_0767Help
Entry
PAS_chr2-1_0767   CDS       T01092                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00010  Glycolysis / Gluconeogenesis
ppa00620  Pyruvate metabolism
ppa00640  Propanoate metabolism
ppa00680  Methane metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr2-1_0767
   00620 Pyruvate metabolism
    PAS_chr2-1_0767
   00640 Propanoate metabolism
    PAS_chr2-1_0767
  Energy metabolism
   00680 Methane metabolism
    PAS_chr2-1_0767
Enzymes [BR:ppa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAS_chr2-1_0767
Lipid biosynthesis proteins [BR:ppa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAS_chr2-1_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 8198044
NCBI-ProteinID: XP_002491701
UniProt: C4R1P7
Position
2:1460130..1462136
Genome map
AA seq 668 aa AA seqDB search
MPLDNEHLLHENSIDPPKGFFERHPGTPNIPGGWEEYLKLYNQSIENPSKFFGEKAKEFL
SWATPFTDARYPPGNGFQNGDSAAWFLNGELNASYNCVDRHALKNPDKPAIIYEADEPNQ
GRTVTYGELLKDVCRIAQVLTDLGVKKGDTVAVYLPMVPEAITTLLAIVRIGAIHSVVFA
GFSAGSLRDRILDADSRIVITSDESLRGGKIIETKKIVDEALKSCPDVRNVLVFKRTGTP
HLPWVEGRDLWWHEEIIKHVPYSPPVNVRSEDTSFLLYTSGSTGKPKGIQHSTAGYLLGA
LLTTKYVFDVQGDDILFTAGDVGWITGHSYVVYGPLLNGATTVVFEGTPAYPDYSRYWDI
VDKHKVTQFYVAPTALRLLKRAGSKYVQNHDLSSIRVLGSVGEPIAAEVWEWYNEYVGRG
KAHICDTYWQTETGSHIIAPIAGVSKTKPGSASFPFFGIDPVILDATTGEELKGNNVEGV
LAIRNPWPSMARTVWKDYNRFLDTYLRPYEGYYFTGDGAARDQEGFYWVLGRVDDVVNVS
GHRLSTAEIESALIEHNLVGESAVVGFPDELTGSAVAAFVSLKKDVDNPAEVKKELILTV
RKEIGPFAAPKLIILVSDLPKTRSGKIMRRILRKVLAGEEDSLGDISTLSNPSIVEEIIS
TVKRDARK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccattagataacgaacacttacttcatgaaaattccattgacccaccaaagggattc
tttgaaagacaccctggaactcctaatataccaggcggttgggaagaatacttgaagctg
tacaatcagtccatcgagaacccctcaaagttttttggagaaaaagcaaaggaattcttg
tcatgggctactcctttcactgacgctcgttacccacctggtaatggatttcagaatggt
gactccgccgcttggtttctgaatggtgagttgaacgcgtcgtacaactgtgttgataga
catgctttaaagaatccagacaaacctgccattatttatgaggctgatgaacctaatcaa
ggccgtacggttacctatggagagttgctgaaggatgtttgtcgaattgcccaagtattg
actgacctgggtgtgaaaaagggtgacactgttgctgtttacctgcctatggttccagaa
gctatcaccactttattggctatcgttagaatcggtgctatccactctgttgtcttcgca
ggtttttcagctggttctctacgtgatcgtatattggatgctgattctagaattgttatc
acttctgatgaatctctgagaggtgggaagatcatcgagactaagaagattgttgacgag
gctctgaagtcttgcccagatgttcgtaatgtgctggtcttcaaaagaacaggtacacca
catcttccatgggttgagggtcgtgatctttggtggcacgaggaaatcattaagcatgtt
ccgtactctcccccagtgaatgttagatctgaagatacttcatttttgctttacacttct
ggctctaccggaaagcctaaaggtatccagcattcaactgctggctacttactgggagct
cttttgaccaccaagtatgtctttgatgttcagggtgatgatattttattcactgctggt
gatgtgggctggatcacagggcattcttatgtagtttacggtccacttttaaacggggct
acgacagttgtttttgagggcaccccagcttacccagactattcacgttattgggatatc
gttgacaaacacaaagttactcagttttatgtagcaccaactgctcttaggttgctgaag
agagctggtagcaagtatgtccagaatcatgatttgtcttcaatcagggttttgggttcc
gttggtgaacctatagccgctgaagtttgggaatggtacaacgagtatgttggaagagga
aaagctcatatttgtgatacgtattggcaaacagagactggttctcacattattgctcca
atagctggtgtgtcaaagaccaaaccaggttcagcatctttccccttcttcggtattgat
ccggttattctagatgctactactggagaggaactcaaaggtaataatgttgaaggtgtt
ttggctatcagaaatccatggccatctatggctagaacagtctggaaggactacaaccgt
ttcctggatacatatctcaggccatatgaaggttattacttcactggtgatggagctgcc
agagatcaggaaggattttattgggttctgggtagagttgatgatgttgttaatgtgtca
ggtcacagattgtctactgccgagattgaaagcgctctaatcgaacacaatttggtagga
gagtctgctgtcgtcggattccctgacgagctgactggttctgctgtggccgcgtttgtg
tctttgaagaaggacgtcgacaatccagcggaagtgaaaaaggagttaatccttactgtc
agaaaagagattggaccattcgctgcacctaaactcatcatcttggtaagtgatcttcca
aagaccagatcaggtaagataatgagacgtattctcagaaaggttttggctggagaggaa
gactctctgggcgacatttcaactctttcaaacccttcgattgtggaagagataatctct
accgttaaaagggatgcccgcaaatga

DBGET integrated database retrieval system