KEGG   Pichia pastoris: PAS_chr2-1_0767Help
Entry
PAS_chr2-1_0767   CDS       T01092                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppa  Pichia pastoris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppa00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1460130..1462136
Genome map
AA seq 668 aa AA seqDB search
MPLDNEHLLHENSIDPPKGFFERHPGTPNIPGGWEEYLKLYNQSIENPSKFFGEKAKEFL
SWATPFTDARYPPGNGFQNGDSAAWFLNGELNASYNCVDRHALKNPDKPAIIYEADEPNQ
GRTVTYGELLKDVCRIAQVLTDLGVKKGDTVAVYLPMVPEAITTLLAIVRIGAIHSVVFA
GFSAGSLRDRILDADSRIVITSDESLRGGKIIETKKIVDEALKSCPDVRNVLVFKRTGTP
HLPWVEGRDLWWHEEIIKHVPYSPPVNVRSEDTSFLLYTSGSTGKPKGIQHSTAGYLLGA
LLTTKYVFDVQGDDILFTAGDVGWITGHSYVVYGPLLNGATTVVFEGTPAYPDYSRYWDI
VDKHKVTQFYVAPTALRLLKRAGSKYVQNHDLSSIRVLGSVGEPIAAEVWEWYNEYVGRG
KAHICDTYWQTETGSHIIAPIAGVSKTKPGSASFPFFGIDPVILDATTGEELKGNNVEGV
LAIRNPWPSMARTVWKDYNRFLDTYLRPYEGYYFTGDGAARDQEGFYWVLGRVDDVVNVS
GHRLSTAEIESALIEHNLVGESAVVGFPDELTGSAVAAFVSLKKDVDNPAEVKKELILTV
RKEIGPFAAPKLIILVSDLPKTRSGKIMRRILRKVLAGEEDSLGDISTLSNPSIVEEIIS
TVKRDARK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccattagataacgaacacttacttcatgaaaattccattgacccaccaaagggattc
tttgaaagacaccctggaactcctaatataccaggcggttgggaagaatacttgaagctg
tacaatcagtccatcgagaacccctcaaagttttttggagaaaaagcaaaggaattcttg
tcatgggctactcctttcactgacgctcgttacccacctggtaatggatttcagaatggt
gactccgccgcttggtttctgaatggtgagttgaacgcgtcgtacaactgtgttgataga
catgctttaaagaatccagacaaacctgccattatttatgaggctgatgaacctaatcaa
ggccgtacggttacctatggagagttgctgaaggatgtttgtcgaattgcccaagtattg
actgacctgggtgtgaaaaagggtgacactgttgctgtttacctgcctatggttccagaa
gctatcaccactttattggctatcgttagaatcggtgctatccactctgttgtcttcgca
ggtttttcagctggttctctacgtgatcgtatattggatgctgattctagaattgttatc
acttctgatgaatctctgagaggtgggaagatcatcgagactaagaagattgttgacgag
gctctgaagtcttgcccagatgttcgtaatgtgctggtcttcaaaagaacaggtacacca
catcttccatgggttgagggtcgtgatctttggtggcacgaggaaatcattaagcatgtt
ccgtactctcccccagtgaatgttagatctgaagatacttcatttttgctttacacttct
ggctctaccggaaagcctaaaggtatccagcattcaactgctggctacttactgggagct
cttttgaccaccaagtatgtctttgatgttcagggtgatgatattttattcactgctggt
gatgtgggctggatcacagggcattcttatgtagtttacggtccacttttaaacggggct
acgacagttgtttttgagggcaccccagcttacccagactattcacgttattgggatatc
gttgacaaacacaaagttactcagttttatgtagcaccaactgctcttaggttgctgaag
agagctggtagcaagtatgtccagaatcatgatttgtcttcaatcagggttttgggttcc
gttggtgaacctatagccgctgaagtttgggaatggtacaacgagtatgttggaagagga
aaagctcatatttgtgatacgtattggcaaacagagactggttctcacattattgctcca
atagctggtgtgtcaaagaccaaaccaggttcagcatctttccccttcttcggtattgat
ccggttattctagatgctactactggagaggaactcaaaggtaataatgttgaaggtgtt
ttggctatcagaaatccatggccatctatggctagaacagtctggaaggactacaaccgt
ttcctggatacatatctcaggccatatgaaggttattacttcactggtgatggagctgcc
agagatcaggaaggattttattgggttctgggtagagttgatgatgttgttaatgtgtca
ggtcacagattgtctactgccgagattgaaagcgctctaatcgaacacaatttggtagga
gagtctgctgtcgtcggattccctgacgagctgactggttctgctgtggccgcgtttgtg
tctttgaagaaggacgtcgacaatccagcggaagtgaaaaaggagttaatccttactgtc
agaaaagagattggaccattcgctgcacctaaactcatcatcttggtaagtgatcttcca
aagaccagatcaggtaagataatgagacgtattctcagaaaggttttggctggagaggaa
gactctctgggcgacatttcaactctttcaaacccttcgattgtggaagagataatctct
accgttaaaagggatgcccgcaaatga

DBGET integrated database retrieval system