KEGG   Pichia pastoris: PAS_chr2-1_0767Help
Entry
PAS_chr2-1_0767   CDS       T01092                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppa  Pichia pastoris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAS_chr2-1_0767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr2-1_0767
   00620 Pyruvate metabolism
    PAS_chr2-1_0767
   00640 Propanoate metabolism
    PAS_chr2-1_0767
  Energy metabolism
   00680 Methane metabolism
    PAS_chr2-1_0767
Enzymes [BR:ppa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAS_chr2-1_0767
Lipid biosynthesis proteins [BR:ppa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAS_chr2-1_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1460130..1462136
Genome map
AA seq 668 aa AA seqDB search
MPLDNEHLLHENSIDPPKGFFERHPGTPNIPGGWEEYLKLYNQSIENPSKFFGEKAKEFL
SWATPFTDARYPPGNGFQNGDSAAWFLNGELNASYNCVDRHALKNPDKPAIIYEADEPNQ
GRTVTYGELLKDVCRIAQVLTDLGVKKGDTVAVYLPMVPEAITTLLAIVRIGAIHSVVFA
GFSAGSLRDRILDADSRIVITSDESLRGGKIIETKKIVDEALKSCPDVRNVLVFKRTGTP
HLPWVEGRDLWWHEEIIKHVPYSPPVNVRSEDTSFLLYTSGSTGKPKGIQHSTAGYLLGA
LLTTKYVFDVQGDDILFTAGDVGWITGHSYVVYGPLLNGATTVVFEGTPAYPDYSRYWDI
VDKHKVTQFYVAPTALRLLKRAGSKYVQNHDLSSIRVLGSVGEPIAAEVWEWYNEYVGRG
KAHICDTYWQTETGSHIIAPIAGVSKTKPGSASFPFFGIDPVILDATTGEELKGNNVEGV
LAIRNPWPSMARTVWKDYNRFLDTYLRPYEGYYFTGDGAARDQEGFYWVLGRVDDVVNVS
GHRLSTAEIESALIEHNLVGESAVVGFPDELTGSAVAAFVSLKKDVDNPAEVKKELILTV
RKEIGPFAAPKLIILVSDLPKTRSGKIMRRILRKVLAGEEDSLGDISTLSNPSIVEEIIS
TVKRDARK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccattagataacgaacacttacttcatgaaaattccattgacccaccaaagggattc
tttgaaagacaccctggaactcctaatataccaggcggttgggaagaatacttgaagctg
tacaatcagtccatcgagaacccctcaaagttttttggagaaaaagcaaaggaattcttg
tcatgggctactcctttcactgacgctcgttacccacctggtaatggatttcagaatggt
gactccgccgcttggtttctgaatggtgagttgaacgcgtcgtacaactgtgttgataga
catgctttaaagaatccagacaaacctgccattatttatgaggctgatgaacctaatcaa
ggccgtacggttacctatggagagttgctgaaggatgtttgtcgaattgcccaagtattg
actgacctgggtgtgaaaaagggtgacactgttgctgtttacctgcctatggttccagaa
gctatcaccactttattggctatcgttagaatcggtgctatccactctgttgtcttcgca
ggtttttcagctggttctctacgtgatcgtatattggatgctgattctagaattgttatc
acttctgatgaatctctgagaggtgggaagatcatcgagactaagaagattgttgacgag
gctctgaagtcttgcccagatgttcgtaatgtgctggtcttcaaaagaacaggtacacca
catcttccatgggttgagggtcgtgatctttggtggcacgaggaaatcattaagcatgtt
ccgtactctcccccagtgaatgttagatctgaagatacttcatttttgctttacacttct
ggctctaccggaaagcctaaaggtatccagcattcaactgctggctacttactgggagct
cttttgaccaccaagtatgtctttgatgttcagggtgatgatattttattcactgctggt
gatgtgggctggatcacagggcattcttatgtagtttacggtccacttttaaacggggct
acgacagttgtttttgagggcaccccagcttacccagactattcacgttattgggatatc
gttgacaaacacaaagttactcagttttatgtagcaccaactgctcttaggttgctgaag
agagctggtagcaagtatgtccagaatcatgatttgtcttcaatcagggttttgggttcc
gttggtgaacctatagccgctgaagtttgggaatggtacaacgagtatgttggaagagga
aaagctcatatttgtgatacgtattggcaaacagagactggttctcacattattgctcca
atagctggtgtgtcaaagaccaaaccaggttcagcatctttccccttcttcggtattgat
ccggttattctagatgctactactggagaggaactcaaaggtaataatgttgaaggtgtt
ttggctatcagaaatccatggccatctatggctagaacagtctggaaggactacaaccgt
ttcctggatacatatctcaggccatatgaaggttattacttcactggtgatggagctgcc
agagatcaggaaggattttattgggttctgggtagagttgatgatgttgttaatgtgtca
ggtcacagattgtctactgccgagattgaaagcgctctaatcgaacacaatttggtagga
gagtctgctgtcgtcggattccctgacgagctgactggttctgctgtggccgcgtttgtg
tctttgaagaaggacgtcgacaatccagcggaagtgaaaaaggagttaatccttactgtc
agaaaagagattggaccattcgctgcacctaaactcatcatcttggtaagtgatcttcca
aagaccagatcaggtaagataatgagacgtattctcagaaaggttttggctggagaggaa
gactctctgggcgacatttcaactctttcaaacccttcgattgtggaagagataatctct
accgttaaaagggatgcccgcaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system