KEGG   Pichia pastoris: PAS_chr2-1_0872Help
Entry
PAS_chr2-1_0872   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAS_chr2-1_0872
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAS_chr2-1_0872
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAS_chr2-1_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1184788..1185909
Genome map
AA seq 373 aa AA seqDB search
MDKSLKNYWEFVLQEQQTMTQRKIVYNISSDYRIQRVLGEGAYGIVCLAKHLPTGTDVAI
KKIQPFERTLFCLRTLREIKILKHFKHENIVALLDVQKPMSLETFNEVYLIQEYMETDLH
KVILSQNLTNDHYQYFIYQILRALKSLHGCNIVHRDLKPSNILLNSNCDLKVCDFGLSRV
HLNDDGRASHVPKISMLTEYVATRWYRAPEIMLTSSQYSTAIDMWAVGCILAELYLRKPL
FPGKDYRHQLLLIFEIIGTPTGIDYQSIKSVKAKEYIKSLPCYSKIPFGKIFRHNDPQGL
DLLGKLLTFNPQNRISVEEALSHPYLSSYHDPLDEPFSNPIPPDFFSFDTEKAQMDGNEL
KKLLYQEIMTFDQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggataagtcattaaagaactattgggaattcgttttgcaagagcagcagacaatgaca
cagagaaaaattgtctataacatttctagcgactatagaatccagagggttttgggtgag
ggtgcgtatggcatagtgtgtcttgcgaagcatttgccaactggcactgatgttgcaatt
aagaagatccaaccattcgaacgaactttgttttgcttaaggactctaagggagatcaaa
attctgaaacatttcaaacatgagaacattgttgcccttctggatgtccagaaaccaatg
agtttagaaaccttcaatgaagtttatctaattcaagaatacatggaaacagatcttcat
aaagtcatattatctcaaaatctaactaatgaccactatcagtattttatttatcagata
ctaagggcactaaagagtctacacgggtgtaatatagtgcatcgagacttgaaaccttcc
aatatcttgctaaattccaactgtgatctcaaagtctgtgattttggattatcaagggtg
catcttaatgatgatgggcgagcctcacacgtaccaaagatttcaatgttgacagaatat
gttgcaaccagatggtacagagcacctgagatcatgttgacatcatctcagtactctacg
gccattgatatgtgggcggtaggttgcattttggctgaattatacctccgaaaaccgcta
tttcctggtaaggactatcgacaccagttgctactaattttcgaaatcatcggcacccca
acaggaattgattatcaatccattaaatccgtcaaagcgaaagagtacatcaaatcgcta
ccttgctacagcaagattccatttggcaaaatatttcgtcacaatgaccctcaaggtttg
gaccttttgggaaagctactgacttttaatccgcagaatcgaatatctgtggaggaagct
ctaagtcatccctacctgtcatcctaccacgacccacttgatgagccattctctaatcca
atccctccagactttttctcatttgatactgaaaaggctcaaatggatggaaacgagctg
aagaaactactgtatcaggaaatcatgacatttgatcagtaa

DBGET integrated database retrieval system