KEGG   Pichia pastoris: PAS_chr2-2_0016Help
Entry
PAS_chr2-2_0016   CDS       T01092                                 

Definition
Histone deacetylase
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PAS_chr2-2_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2363444..2364832
Genome map
AA seq 462 aa AA seqDB search
MVHTWSDESSIQLDGKSVLNAPLYETNYGNTYKSNVSYHFNPNVSKYHYGVRHPMKPFRL
LLTDHLVISYKLYEQMDLYQPRSATEDELKQFHSDDYITFLKNVTPENSNKFIQDLRKFN
IGDDCPVFEGIFDYSSYYAGASLDASRKLINGQSDIAINWSGGLHHAKKSEPSGFCYVND
IVLSILNLLRVHPRVLYIDIDIHHGDGVQEAFYLSDRVMTVSFHQYNGQFFPGTGNYDET
GLGVGKHFALNVPLRDGIDDENYVRLFKSVMEPLIRSFQPTCIVQQCGADSLGCDRLGGF
NLNIRAHGECVNFIKSFGIPLLVLGGGGYTPRNVSRLWCYETSIMTNTKLASKLPEELPF
RNFFEPDYSLHPNLGDRIENKNTRKYLESVRIRVMEQLRYLNGAPSVAMQEIPPDIQGID
TTDEEEALIKQLNKESELDALLEEDRYWLNEKENARVGELRD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggttcatacgtggtctgatgagtcatctatccaattagatggcaaatcagttctaaac
gcaccactgtatgaaactaattacggaaatacctataaatcgaatgtctcctatcacttc
aatccaaacgtctccaaatatcattatggggtacgacacccaatgaaaccgttccggtta
ctattgactgatcatttggtcatttcttacaagctgtatgaacagatggatctgtatcag
ccaagaagtgccactgaggatgaactaaagcagtttcattctgatgactatattacattc
ctgaagaatgtcacaccggagaacagtaacaagttcattcaagatcttcgtaagtttaat
attggagacgactgtccagtctttgagggcatatttgactattcatcctactatgcaggc
gcatcgttagatgcgtctaggaagttaatcaatgggcaatccgacattgccattaactgg
tcaggaggcttacatcatgccaagaaatcagagcccagtggattctgttatgttaatgat
attgtgctatccattttgaacctcctcagagtgcatccaagagttttgtatatagatatt
gacattcatcatggagacggggtccaagaagctttctacctctcagatagagtcatgaca
gtttcctttcaccaatataacggtcagttttttcctgggactggtaattacgatgagacg
gggcttggagttgggaaacactttgccctcaatgttccacttagagatggtattgacgat
gagaactatgtcagacttttcaagtctgtcatggagccattaataagatccttccaaccc
acgtgtatagtacaacaatgtggtgccgattctttggggtgtgatcgattgggtggattt
aatttgaatatcagagctcatggtgagtgtgtgaatttcatcaagtcgttcggaatccct
ctcctagttttaggtggaggaggatacactcctagaaatgtcagtcgtctctggtgttat
gagacgagcatcatgaccaatacgaaattagcttcaaagcttccggaggaattgcctttt
aggaatttcttcgaaccggattactcactgcatcctaacctgggtgatcgaattgaaaac
aaaaacacaagaaaatacctggaaagtgtacgaatcagagtaatggaacaactacgttac
cttaatggtgccccaagcgttgccatgcaggaaatacctccggatatccaaggcatagac
actactgatgaggaagaggcgctgataaaacagttgaataaagaaagtgaattggatgca
ttgctagaagaggataggtactggcttaacgagaaagaaaatgctagagttggagaactt
agagattaa

DBGET integrated database retrieval system