KEGG   Komagataella pastoris: PAS_chr2-2_0056Help
Entry
PAS_chr2-2_0056   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ppa  Komagataella pastoris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAS_chr2-2_0056
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAS_chr2-2_0056
Peptidases [BR:ppa01002]
 Metallo Peptidases
  Family M67
   PAS_chr2-2_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2277198..2278472
Genome map
AA seq 424 aa AA seqDB search
MKSSKELYKEALNYEYSSAVSFKAWVRSAQIILRHARQFAEQRYISECYKLSVRFVDLIV
NKMATHKELKQLKKINAPVYLTYLDLATKKVPDVIKECEALKTILDDEYQSYLKLQQLKR
QKQKDQLIHHQNQAQTHKLRRSSSILKDHINAVDERALLKQLQQLTYHDREFATAITEMP
NYPEIPQLSISTNQNTRSEAPPLPPRVSQEQSLAPVSLDSSQADLQHKTVNFTEAGQPLR
TVFISDRLQSEFLRLAEPNTIQKLETCGILCGKLVRNAFFITHLVIPDQESTPNTCNTRN
EEKLFDTIDQLDLFVLGWIHTHPTQSCFLSSIDLHTQNSYQIMLSEAIAIVCAPAPQFSH
HSFGCFRLTHPPGIPTITQCTRTGFHPHEEPNLYVTCNRKNMGDVQGGHVVIKNHLPFEK
LDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctctaaagaactatacaaggaggctctcaactatgaatactcttccgcggtt
tctttcaaggcctgggttcgaagtgctcaaatcattttgcgacatgcccggcagtttgct
gaacaaagatacatcagtgagtgctataagttgtctgttcgttttgtagacttgattgtg
aacaagatggccacgcataaagagctcaagcaattgaagaaaataaatgcaccagtatat
ctcacctatttggatttggctacgaagaaagtcccagatgtcatcaaggaatgtgaggcc
ttgaagacaattttggatgatgagtaccaaagctacctcaaactgcaacaattgaaacga
cagaagcagaaagaccaattgatccatcatcagaatcaggctcaaacgcataaattacgt
agatcttcatcaatattgaaagatcatatcaacgctgttgatgaaagagcgctgttgaaa
caactacagcagttgacataccatgatcgtgaattcgcaaccgcaataacggagatgcca
aattatccagagatcccccagctgagtatttcaacgaatcagaacactagatcagaggca
cccccacttccaccaagagtatcgcaggaacagtcattagcaccagtatcactagattca
tcacaggcagatttacaacacaaaactgttaacttcaccgaagctgggcaaccattacga
acagtatttatttcagatagactccaatctgagttccttagactagcggaaccaaacacg
atacaaaagctagagacttgtggcatcctttgtggaaagctcgtcagaaatgcattcttc
atcacccatttggttataccagatcaagagtcgacaccaaacacatgtaatacaagaaat
gaggaaaagttattcgacactatagatcagcttgatttatttgtccttggatggatacat
acccacccaacacaatcatgcttcctgtcttccatagacttacatacacagaattcgtac
cagatcatgttaagcgaagcaattgccattgtgtgtgcaccagcacctcagttttctcat
cattcttttggatgttttcggctaacccatcctccgggaattccaaccattacacaatgc
actaggacgggatttcatcctcatgaggaacccaatctgtatgtgacttgtaatcgaaag
aacatgggcgacgtgcaaggcggacacgttgtgatcaagaatcatttaccgtttgaaaag
cttgatctaagataa

DBGET integrated database retrieval system