KEGG   Pichia pastoris: PAS_chr2-2_0056Help
Entry
PAS_chr2-2_0056   CDS       T01092                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ppa  Pichia pastoris
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ppa04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2277198..2278472
Genome map
AA seq 424 aa AA seqDB search
MKSSKELYKEALNYEYSSAVSFKAWVRSAQIILRHARQFAEQRYISECYKLSVRFVDLIV
NKMATHKELKQLKKINAPVYLTYLDLATKKVPDVIKECEALKTILDDEYQSYLKLQQLKR
QKQKDQLIHHQNQAQTHKLRRSSSILKDHINAVDERALLKQLQQLTYHDREFATAITEMP
NYPEIPQLSISTNQNTRSEAPPLPPRVSQEQSLAPVSLDSSQADLQHKTVNFTEAGQPLR
TVFISDRLQSEFLRLAEPNTIQKLETCGILCGKLVRNAFFITHLVIPDQESTPNTCNTRN
EEKLFDTIDQLDLFVLGWIHTHPTQSCFLSSIDLHTQNSYQIMLSEAIAIVCAPAPQFSH
HSFGCFRLTHPPGIPTITQCTRTGFHPHEEPNLYVTCNRKNMGDVQGGHVVIKNHLPFEK
LDLR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctctaaagaactatacaaggaggctctcaactatgaatactcttccgcggtt
tctttcaaggcctgggttcgaagtgctcaaatcattttgcgacatgcccggcagtttgct
gaacaaagatacatcagtgagtgctataagttgtctgttcgttttgtagacttgattgtg
aacaagatggccacgcataaagagctcaagcaattgaagaaaataaatgcaccagtatat
ctcacctatttggatttggctacgaagaaagtcccagatgtcatcaaggaatgtgaggcc
ttgaagacaattttggatgatgagtaccaaagctacctcaaactgcaacaattgaaacga
cagaagcagaaagaccaattgatccatcatcagaatcaggctcaaacgcataaattacgt
agatcttcatcaatattgaaagatcatatcaacgctgttgatgaaagagcgctgttgaaa
caactacagcagttgacataccatgatcgtgaattcgcaaccgcaataacggagatgcca
aattatccagagatcccccagctgagtatttcaacgaatcagaacactagatcagaggca
cccccacttccaccaagagtatcgcaggaacagtcattagcaccagtatcactagattca
tcacaggcagatttacaacacaaaactgttaacttcaccgaagctgggcaaccattacga
acagtatttatttcagatagactccaatctgagttccttagactagcggaaccaaacacg
atacaaaagctagagacttgtggcatcctttgtggaaagctcgtcagaaatgcattcttc
atcacccatttggttataccagatcaagagtcgacaccaaacacatgtaatacaagaaat
gaggaaaagttattcgacactatagatcagcttgatttatttgtccttggatggatacat
acccacccaacacaatcatgcttcctgtcttccatagacttacatacacagaattcgtac
cagatcatgttaagcgaagcaattgccattgtgtgtgcaccagcacctcagttttctcat
cattcttttggatgttttcggctaacccatcctccgggaattccaaccattacacaatgc
actaggacgggatttcatcctcatgaggaacccaatctgtatgtgacttgtaatcgaaag
aacatgggcgacgtgcaaggcggacacgttgtgatcaagaatcatttaccgtttgaaaag
cttgatctaagataa

DBGET integrated database retrieval system