KEGG   Pichia pastoris: PAS_chr2-2_0084Help
Entry
PAS_chr2-2_0084   CDS       T01092                                 

Definition
Repressible alkaline phosphatase, a glycoprotein localized to the vacuole
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ppa  Pichia pastoris
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2225270..2226847)
Genome map
AA seq 525 aa AA seqDB search
MDSEPLLPNPNDSRKPANWRRIIKYISLTLAWIGIFSYVYIYHGTASKLTPTKKNVIFMV
TDGMGPASVTVARDFKQFKYDLSWDEQLFIDTYLVGSSRTRSFDSWVTDSAAGATAFSCR
SKTGNNMVAVDYDSKPLGTVLEAAKLQGFKTGISVTTYVSDATPAAFASHSVTRWNADLI
TKHLLGDYPLGRSLDLMVGGGRCFFYGRKDGGCRYDGENLLKTAKHSGWNLLENKTAFDA
LGENNAPVDLPLMVLLAEGNFPFEIDRNASEHPSIGEQTHKVLDILDKATKKDDQGFFVL
IEGSRIDHAGHYNDAAAQVQEVLAFDEAFQAAVEFADDSSVETLIISVSDHETGGLSAAK
QVTPNYPDYAWFPEVLLNVTHSSEYLAAKLSNYKETDLLSFIEEDILQDGMGIYDATPEE
IQAIKKARHKSLDVLSKIISKRAQVGFSTHGHSAVDVNIYAHGNTPALQKRIDKYLRGNH
DNTDIGKFMESWLRVDLDEVTAQLEGLSVGEGSHYSSFGVEQHPL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggactctgagcctctactgccaaatcccaatgatagcagaaagccagccaattggagg
agaattataaagtatatctcattaacattagcttggattggtatcttttcttacgtttac
atctaccatggcacggcgtcaaaattaacccccacaaaaaagaatgtaatctttatggtc
actgatggaatgggtccagcatctgttactgtagcccgtgactttaaacagttcaagtat
gatctttcatgggacgaacaactattcattgacacgtatctcgtgggctcttccagaacg
cgctcctttgattcctgggttacagacagtgccgccggcgcaacagcctttagctgcaga
agtaagactggaaataacatggtagccgtggactacgattcgaagcctctgggaacagtg
ctggaagccgctaaactacaagggttcaagactggtattagcgttactacttacgtttcg
gacgctacaccagctgcatttgcctcgcattcggttactcgttggaatgctgacttgatt
acaaagcacctattgggagactatcccttggggaggtcattggatcttatggttggtggt
ggccgttgtttcttttatggtaggaaagatgggggctgcagatacgatggtgagaaccta
ttgaaaactgctaaacacagcggttggaacctactcgagaacaaaaccgcatttgatgcc
ctgggagagaacaatgcacccgtagatctaccactgatggtattgttggccgaaggaaac
tttccgtttgagatcgaccgtaatgcatctgaacatccgtcaatcggagaacaaacacat
aaagtcctggatattctcgacaaagccactaaaaaggatgatcaaggtttttttgttttg
attgaaggatctagaattgaccacgcgggtcattacaatgatgccgctgcgcaagtgcaa
gaagtattagcattcgatgaagcattccaagcagccgtagaatttgctgacgattcatcg
gtggagacattgattatctccgtgtcggatcatgagacagggggtctatccgcagccaaa
caagtcaccccgaattatcctgattatgcgtggtttccggaagtactgctaaatgtgaca
cattctagtgagtaccttgccgcaaaattgagcaattacaaagaaactgatcttctctca
tttatcgaagaggacatcctccaagatggaatgggaatctatgacgccactcctgaagag
atccaagctattaaaaaggctcgccataaatctctggatgttctgtcaaaaataatttcg
aaaagggcacaagtggggttttcgacccatggccattcagccgtagacgtgaacatctat
gcacatggaaacacccccgccttacaaaaaagaatcgacaaatacctgcgcggaaaccat
gataatactgatattggaaaatttatggaaagctggttgcgtgtagacctcgatgaggtg
acagcacaactagagggtctatctgttggggagggcagtcattatagctcgttcggggta
gagcagcaccctctttag

DBGET integrated database retrieval system