KEGG   Pichia pastoris: PAS_chr2-2_0103Help
Entry
PAS_chr2-2_0103   CDS       T01092                                 

Definition
Serine-threonine protein kinase that is part of a glucose-sensing system
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ppa  Pichia pastoris
Brite
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAS_chr2-2_0103
Protein kinases [BR:ppa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PAS_chr2-2_0103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2183810..2186014
Genome map
AA seq 734 aa AA seqDB search
MSFNDRQGWKQRAQSSNQGDPAFKNVFSVCSTGSYNIPNNGSQIPVRGFQELDLSPSFKR
NDQWFDSPSRRESNIAQQNLSLLQNGSRPSFSQQLPTTYEHEGMGPPAEEVVLPPPRAAA
PGPMQSHLNMQEEQFKEYQRRQSVAVSGSHYQTPPGAVTKTTKLPVPRMRRIRALSDFHP
VRNAKPKYRRASSASQYISPLIALSISLSSTYRICRPEFSYNIAKNPRRVLTKPSEPKLN
NGYDNIDSDYIQYVHDVLGIEENKKYMVLDILGQGTFGQVVKCQNLKTQEIVAVKVIKSK
AAFLNQSMIEAEILDHLNKNIDPQDVHHFLRLKDKFIHRNHLCLVFELLSSNLYELIKQN
KFQGLSIKLVRKFAIQLLDSLCVLKNAKLVHCDLKPENILLVYPDKPQLKIIDFGTACYE
GQPVYTYIQSRFYRSPEVVLGLSYSTSIDMWSFGCIVAELFLGLPLFPGTSEYNLLARVI
DMLGMPPHFMIEMGKNSPNYFTRINSTQYKFKNVEQFSQDPDVWKRERESKSYFTHRYLN
EIILNYELPKKNMTYSMIDKEMRQRECLVHFLMGVLNLNPLKRWSPQQASAHPFITGQPF
NSNWTPPGFSVHNSGGSETELHSSEKTQETQPEPSTYSNTPVSQAYRSSFTKQERPPQQH
QYSYGYASSQAIPPKEVPKSKLQQYTSNYSVSSGSSSSKSSSMAGSITGEDIETDTGQTM
FKQGYSIQKASDKK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatgacaggcaaggatggaagcaaagggcgcagagtagcaatcaaggagat
cctgcgttcaaaaacgtcttctctgtatgctcaacaggatcctacaatatcccaaacaat
gggtctcagattcctgttcgtggatttcaagaactggatctttctccaagcttcaaacga
aacgatcaatggtttgattcgccatcacgcagagagtctaatattgcgcagcaaaatctg
tctcttcttcaaaatggttctagaccgtcgttcagtcagcagctgcccacaacgtatgaa
catgaaggaatgggcccaccagcagaagaagtagttttgccaccaccaagggccgctgca
ccaggacctatgcaatcccacctcaacatgcaggaggaacagttcaaagagtaccaaaga
agacaatcggtggctgtttcaggatcccattatcaaacacctcctggagcggtaacgaag
acaaccaagttgcccgttcccagaatgcgccgaataagagcactttcagactttcatcca
gtaagaaatgccaagcctaaatacagaagagcttcatcagcatctcaatatatttctccc
ctaatagcgttgtccatttcacttagttccacttatcgtatatgccgaccagagttcagt
tacaatattgcaaagaaccctcgaagagtgttaaccaaaccaagtgagcctaagctcaac
aatggctacgacaatattgacagtgactacattcaatacgtccacgatgttttgggtatt
gaggagaataagaaatatatggttctcgacattttaggccagggaacttttggacaagtg
gtaaagtgtcagaacttgaaaacacaagaaatcgtagcagtcaaagttatcaagtcaaag
gctgcttttttaaaccagtcaatgattgaggctgaaatactagaccatttgaacaaaaat
attgacccacaggatgttcaccactttttaaggttaaaagataagttcattcatcgcaac
catttgtgtttggtatttgaacttctttcttcgaacctttacgaattaataaagcaaaac
aagttccaaggtctttctattaaactggtcaggaagtttgcaattcaattgttggattca
ctttgtgtgttgaagaatgcgaaattggttcattgtgacctgaagccagagaatatctta
ttggtctacccagacaaacctcaattgaagattattgatttcggaacagcatgctacgaa
ggtcagcctgtatacacatatattcaatctcgattctatcgatctccagaagttgttttg
ggtttatcatattcaacatctattgacatgtggtcgtttggatgcattgtggctgagctg
tttttgggattgcctctttttccaggaacttcagaatacaacttattggccagagtaatt
gacatgttaggaatgcctccacatttcatgatagaaatgggtaagaattcacctaattac
tttacgaggataaattccactcagtacaagttcaagaatgtggaacaattttctcaagat
ccagatgtttggaagagagaaagagaaagtaaatcatactttacacacagatatttaaat
gagataatacttaattatgaattgccaaagaaaaatatgacatatagcatgattgacaaa
gagatgcgtcagcgagaatgtttggtgcattttttgatgggagtcttgaacctgaatccg
ttgaaaagatggtctccccagcaagcaagtgcacacccattcatcacaggtcaaccgttt
aattccaattggacacctcctggatttagtgttcacaattctggcggatcggaaacggag
ttacactcctcagagaagacgcaggaaacacaacctgaacccagcacatactcaaataca
ccagtcagtcaagcatatcgttcgtcattcaccaagcaagagcggcctcctcaacagcat
caatactcgtatggatatgcttcatcccaagctattccaccaaaggaagtccccaaatct
aaattacaacagtacacaagcaattatagtgtatcaagcggatcttcaagctcaaagtcc
tcgtctatggcgggttccatcacgggcgaagatatcgagactgatactggccaaacaatg
ttcaagcaaggatactcgatccaaaaggcaagtgataaaaagtag

DBGET integrated database retrieval system